Melanoma Antigen Family A, 4


Background

Catalog Number:

CPTC-MAGEA4-1

Target Antigen:

Melanoma Antigen Family A, 4

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-MAGEA4-1 for NCI60  Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-MAGEA4-1 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-MAGEA4-1 for NCI60 Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-MAGEA4-1. Titer: 1:100 Click image to enlarge

CPTC-MAGEA4-1 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-MAGEA4-1. Titer: 1:100


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MAGEA4-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MAGEA4-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Click image to enlarge

CPTC-MAGEA4-1 NCI60 Protein Array

Result: Positive

Protein Array in which CPTC-MAGEA4-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MAGEA4-1 as primary Ab against Ag 10479 (lane 2).
Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MAGEA4-1 Western Blot

Result: Positive

Western Blot using CPTC-MAGEA4-1 as primary Ab against Ag 10479 (lane 2).
Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-MAGEA4-2

Target Antigen:

Melanoma Antigen Family A, 4

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-MAGEA4-2 for NCI60  Cell Line Array at titer 1:1250
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-MAGEA4-2 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-MAGEA4-2 for NCI60 Cell Line Array at titer 1:1250
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-MAGEA4-2. Titer: 1:1250 Click image to enlarge

CPTC-MAGEA4-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-MAGEA4-2. Titer: 1:1250


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MAGEA4-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MAGEA4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-MAGEA4-2 NCI60 Protein Array

Result: Positive

Protein Array in which CPTC-MAGEA4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MAGEA4-2 as primary Ab against Ag 10479 (lane 2).
Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MAGEA4-2 Western blot

Result: Positive

Western Blot using CPTC-MAGEA4-2 as primary Ab against Ag 10479 (lane 2).
Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-MAGEA4-3

Target Antigen:

Melanoma Antigen Family A, 4

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MAGEA4-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MAGEA4-3 as primary Ab against Ag 10479 (lane 2).
Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MAGEA4-3 Western blot

Result: Positive

Western Blot using CPTC-MAGEA4-3 as primary Ab against Ag 10479 (lane 2).
Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10479

Antigen Name:

Melanoma Antigen Family A, 4

CPTC Name:

CPTC-MAGEA4

Keywords:

CT1.4; MAGE-41; MAGE-X2; MAGE4; MAGE4A; MAGE4B; MGC21336; OTTHUMP00000025889; OTTHUMP00000025890

Function:

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. At least four variants encoding the same protein have been found for this gene. The function is not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression

Chromosomal Localization:

Xq28

Expression System:

E. Coli

NCBI Accession Number:

BC017723.1

Swiss Prot Accession Number:

P43358

DNA Source:

HIP: HsCD00043768

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

38515

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLV
PGTLEEVPAAESAGPPQSPQGASALPTTISFTCWRQPNEGSSSQEEEGPS
TSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRC
FPVIFGKASESLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDGLLGNNQIF
PKTGLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLL
TQDWVQENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNAR
VRIAYPSLREAALLEEEEGV

Native Sequence:

MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGT
LEEVPAAESAGPPQSPQGASALPTTISFTCWRQPNEGSSSQEEEGPSTSP
DAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPV
IFGKASESLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDGLLGNNQIFPKT
GLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQD
WVQENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRI
AYPSLREAALLEEEEGV

Calculated Isoelectric Point:

4.68

Molecular Weight:

35201

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10479 (with molecular weight standards in lane 1)
Click image to enlarge

CPTC-MAGEA4

PAGE of Ag 10479 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com