Catalog Number:
CPTC-CRYAB-1
RRID:
AB_1553790
Target Antigen:
Crystallin Alpha B
Isotype:
IgG2a
Species:
Mouse Monoclonal Antibody
Last Updated:
05/23/2024
Antigen Recognition(s):
Recombinant Full-length, Endogenous
SOP:
Result: Positive
Imaging mass cytometry on ovarian cancer tissue core using CPTC-CRYAB-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (appendix and kidney) and cancer tissue (ovarian).
Result: Positive
This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: Negative
This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.
Result: Negative
This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.
Result: Positive
Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:50
Human assay: U-2 OS fixed with PFA, dilution: 1:50
Human assay: U-251 MG fixed with PFA, dilution: 1:50
Result: Positive
Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Result: Positive
This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.
Result: Negative
This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Result: Positive
Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:250.
Result: Positive
Western Blot using CPTC-CRYAB-1 as primary Ab against Ag 10408 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Catalog Number:
CPTC-CRYAB-2
RRID:
AB_1553792
Target Antigen:
Crystallin Alpha B
Isotype:
IgG2a
Species:
Mouse Monoclonal Antibody
Last Updated:
05/23/2024
Antigen Recognition(s):
Recombinant Full-length, Endogenous
SOP:
Result: Positive
Imaging mass cytometry on ovarian cancer tissue core using CPTC-CRYAB-2 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (appendix and kidney) and cancer tissues (ovarian and prostate).
Result: Positive
This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: Negative
This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.
Result: Negative
This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.
Result: Positive
Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Result: Positive
This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.
Result: Negative
This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Result: Positive
Western Blot using CPTC-CRYAB-2 as primary Ab against Ag 10408 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Catalog Number:
CPTC-CRYAB-3
RRID:
AB_2084322
Target Antigen:
Crystallin Alpha B
Isotype:
IgG2a
Species:
Mouse Monoclonal Antibody
Last Updated:
05/23/2024
Antigen Recognition(s):
Recombinant Full-length, Endogenous
SOP:
Result: Positive
Imaging mass cytometry on lung cancer tissue core using CPTC-CRYAB-3 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (colon, pancreas, breast, lung, appendix, and kidney) and cancer tissues (ovarian and lung).
Result: Positive
This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: Negative
This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.
Result: Negative
This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.
Result: Positive
Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Result: Negative
This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Result: Positive
Western Blot using CPTC-CRYAB-3 as primary Ab against Ag 10408 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
NCI Identification Number:
10408
Antigen Name:
Crystallin Alpha B
CPTC Name:
CPTC-CRYAB
Aliases:
CRYAB; Alpha(B)-crystallin; CRYA2; CTPP2; HSPB5; HspB5
Function:
Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter
class constitutes the major proteins of vertebrate eye lens and maintains the transparency and
refractive index of the lens. Since lens central fiber cells lose their nuclei during development,
these crystallins are made and then retained throughout life, making them extremely stable
proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and
gamma crystallins are also considered as a superfamily. Alpha and beta families are further
divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (sHSP also known as the HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates.
Post-translational modifications decrease the ability to chaperone. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two
additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B gene products are differentially expressed;
alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues
and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a
missense mutation cosegregated in a family with a desmin-related myopathy.
Chromosomal Localization:
11q22.3 - 11q23.1
Expression System:
E. Coli
Accession Number:
BC007008
UniProt Accession Number:
P02511
DNA Source:
HIP:HsCD00004255
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
13980
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPF
YLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDV
IEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNG
PRKQVSGPERTIPITREEKPAVTAAPKK
Native Sequence:
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLR
PPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEV
HGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK
QVSGPERTIPITREEKPAVTAAPKK
Calculated Isoelectric Point:
6.75
Molecular Weight:
20431
Last Updated:
09/01/2008
PAGE of Ag 10408 (with molecular weight standards in lane 1)
Get it for free at Adobe.com