Crystallin Alpha B


Background

Catalog Number:

CPTC-CRYAB-1

Target Antigen:

Crystallin Alpha B

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/25/2013

Antigen Recognition(s):

recombinant full-length

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-CRYAB-1 as primary Ab against Ag 10408 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CRYAB-1 Western Blot

Western Blot using CPTC-CRYAB-1 as primary Ab against Ag 10408 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CRYAB-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-CRYAB-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-CRYAB-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-CRYAB-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  NAPPA
Download CRYAB-1 pos.pdf (1.1 MB)

Evaluation of antibody by NAPPA

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.

Characterization SOP Files

Background

Catalog Number:

CPTC-CRYAB-2

Target Antigen:

Crystallin Alpha B

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/25/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-CRYAB-2 as primary Ab against Ag 10408 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CRYAB-2 Western Blot

Western Blot using CPTC-CRYAB-2 as primary Ab against Ag 10408 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CRYAB-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-CRYAB-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-CRYAB-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-CRYAB-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  NAPPA
Download CRYAB-2 pos.pdf (855.8 KB)

Evaluation of antibody by NAPPA

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.

Characterization SOP Files

Background

Catalog Number:

CPTC-CRYAB-3

Target Antigen:

Crystallin Alpha B

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/25/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-CRYAB-3 as primary Ab against Ag 10408 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CRYAB-3 Western Blot

Western Blot using CPTC-CRYAB-3 as primary Ab against Ag 10408 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CRYAB-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-CRYAB-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-CRYAB-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-CRYAB-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

NCI Identification Number:

10408

Antigen Name:

Crystallin Alpha B

CPTC Name:

CPTC-CRYAB

Keywords:

CRYAB; Alpha(B)-crystallin; CRYA2; CTPP2; HSPB5; HspB5

Function:

Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter
class constitutes the major proteins of vertebrate eye lens and maintains the transparency and
refractive index of the lens. Since lens central fiber cells lose their nuclei during development,
these crystallins are made and then retained throughout life, making them extremely stable
proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and
gamma crystallins are also considered as a superfamily. Alpha and beta families are further
divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (sHSP also known as the HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates.
Post-translational modifications decrease the ability to chaperone. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two
additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B gene products are differentially expressed;
alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues
and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a
missense mutation cosegregated in a family with a desmin-related myopathy.

Chromosomal Localization:

11q22.3 - 11q23.1

Expression System:

E. Coli

NCBI Accession Number:

BC007008

Swiss Prot Accession Number:

P02511

DNA Source:

HIP:HsCD00004255

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

13980

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPF
YLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDV
IEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNG
PRKQVSGPERTIPITREEKPAVTAAPKK

Native Sequence:

MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLR
PPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEV
HGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK
QVSGPERTIPITREEKPAVTAAPKK

Calculated Isoelectric Point:

6.75

Molecular Weight:

20431

Last Updated:

04/09/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click image to enlarge

Ag 10408

PAGE of Ag 10408 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com