tyrosine 3-monooxygenase or tryptophan 5-monooxygenase activation protein, epsilon polypeptide


Background

Catalog Number:

CPTC-YWHAE-1

Target Antigen:

tyrosine 3-monooxygenase or tryptophan 5-monooxygenase activation protein, epsilon polypeptide

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (108.2 KB)

CPTC-YWHAE-1 Evaluation by Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-YWHAE-1 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-YWHAE-1 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-YWHAE-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-YWHAE-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-YWHAE-1 as primary Ab against rYWHAE Ag (NCI-10277) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-YWHAE-1 Western blot

Result: Positive

Western Blot using CPTC-YWHAE-1 as primary Ab against rYWHAE Ag (NCI-10277) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

Background

Catalog Number:

CPTC-YWHAE-2

Target Antigen:

tyrosine 3-monooxygenase or tryptophan 5-monooxygenase activation protein, epsilon polypeptide

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (95.7 KB)

CPTC-YWHAE-2 Evaluation by Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-YWHAE-2 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-YWHAE-2 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-YWHAE-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-YWHAE-2 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-YWHAE-2 as primary Ab against rYWHAE Ag (NCI-10277) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-YWHAE-2 Western blot

Result: Positive

Western Blot using CPTC-YWHAE-2 as primary Ab against rYWHAE Ag (NCI-10277) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

Background

Catalog Number:

CPTC-YWHAE-3

Target Antigen:

tyrosine 3-monooxygenase or tryptophan 5-monooxygenase activation protein, epsilon polypeptide

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (97.8 KB)

CPTC-YWHAE-3 Evaluation by Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (i.e., binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-YWHAE-3 Indirect ELISA

Result: Positive

Indirect ELISA (i.e., binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-YWHAE-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-YWHAE-3 Protein Array

Result: Positive

Protein Array in which CPTC-YWHAE-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-YWHAE-3 as primary Ab against rYWHAE Ag (NCI-10277) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-YWHAE-3 Western blot

Result: Positive

Western Blot using CPTC-YWHAE-3 as primary Ab against rYWHAE Ag (NCI-10277) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10277

Antigen Name:

tyrosine 3-monooxygenase or tryptophan 5-monooxygenase activation protein, epsilon polypeptide

CPTC Name:

CPTC-YWHAE

Keywords:

YWHAE; 14-3-3E; FLJ45465; KCIP-1; MDCR; MDS

Function:

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer.

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner

Chromosomal Localization:

17p13

Expression System:

E. Coli

NCBI Accession Number:

BC001440

Swiss Prot Accession Number:

P62258

DNA Source:

HIP : HsCD00002800

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

28943

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSV
AYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLIC
CDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAEN
SLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA
AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEAL
QDVEDENQ

Native Sequence:

MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYK
NVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDI
LDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLV
AYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFD
DAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDV
EDENQ

Calculated Isoelectric Point:

4.63

Molecular Weight:

29446

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10277 (with molecular weight standards in lane 1)
Click image to enlarge

Ag 10277

PAGE of Ag 10277 (with molecular weight standards in lane 1)

No SOPs available.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com