Metastasin 100 calcium-binding protein A4 (Calvasculin)


Background

Catalog Number:

CPTC-S100A4-1

Target Antigen:

Metastasin 100 calcium-binding protein A4 (Calvasculin)

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for S100A4-1 Ab (635A8.1) using Biacore SPR method Click image to enlarge

CPTC-S100A4-1 SPR

Result: Positive

Kinetic titration data for S100A4-1 Ab (635A8.1) using Biacore SPR method


  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-S100A4-1 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:15000 Click image to enlarge

CPTC-S100A4-1 IHC NCI60

Result: Positive

Immunohistochemistry of CPTC-S100A4-1 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:15000


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-S100A4-1. Titer: 1:15000 Click image to enlarge

CPTC-S100A4-1 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-S100A4-1. Titer: 1:15000


  IPMS
Download This PDF contains the spectra and recommendation for use of this antibody in immuno capture mass spectrometry. (200.3 KB)

CPTC-S100A4-1 Immuno MS

Result: Positive

This PDF contains the spectra and recommendation for use of this antibody in immuno capture mass spectrometry.


  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-S100A4-1 Click image to enlarge

CPTC-S100A4-1 Indirect ELISA

Result: Positive

Indirect ELISA of CPTC-S100A4-1


  NCI 60 Protein Array
Click to enlarge image Protein Array in which S100A4-1 is screen agains the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Click image to enlarge

CPTC-S100A4-1 NCI60 Protein Array

Result: Positive

Protein Array in which S100A4-1 is screen agains the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot Using CPTC-S100A4-1 as primary Ab against Ag 10337(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-S100A4-1 Western Blot

Result: Positive

Western Blot Using CPTC-S100A4-1 as primary Ab against Ag 10337(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).


Background

Catalog Number:

CPTC-S100A4-2

Target Antigen:

Metastasin 100 calcium-binding protein A4 (Calvasculin)

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for S100A4-2 Ab (635A11.1) using Biacore SPR method Click image to enlarge

CPTC-S100A4-2 SPR

Result: Positive

Kinetic titration data for S100A4-2 Ab (635A11.1) using Biacore SPR method


  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (558.4 KB)

CPTC-S100A4-2 evaluation by the Human Protein Atlas

Result: Positive

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).


  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-S100A4-2 for NCI60  Cell Line Array at titer 1:8000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-S100A4-2 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-S100A4-2 for NCI60 Cell Line Array at titer 1:8000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-S100A4-2. Titer: 1:8000 Click image to enlarge

CPTC-S100A4-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-S100A4-2. Titer: 1:8000


  IPMS
Download This PDF contains the spectra and recommendation for use of this antibody in immuno capture mass spectrometry. (199.1 KB)

CPTC-S100A4-2 Immuno-MS

Result: Negative

This PDF contains the spectra and recommendation for use of this antibody in immuno capture mass spectrometry.


  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-S100A4-2 Click image to enlarge

CPTC-S100A4-2 Indirect ELISA

Result: Positive

Indirect ELISA of CPTC-S100A4-2


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-S100A4-2 NCI60 Protein Assay

Result: Positive

Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot Using CPTC-S100A4-2 as primary Ab against Ag 10337(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-S100A4-2 Western Blot

Result: Positive

Western Blot Using CPTC-S100A4-2 as primary Ab against Ag 10337(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).


Background

Catalog Number:

CPTC-S100A4-3

Target Antigen:

Metastasin 100 calcium-binding protein A4 (Calvasculin)

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for S100A4-3 Ab (635A23.1) using Biacore SPR method Click image to enlarge

CPTC-S100A4-3 SPR

Result: Positive

Kinetic titration data for S100A4-3 Ab (635A23.1) using Biacore SPR method


  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (161.4 KB)

CPTC-S100A4-3 evaluation by the Human Protein Atlas

Result: Positive

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (107.0 KB)

CPTC-S100A4-3 Evaluation by Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-S100A4-3 for NCI60  Cell Line Array
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Titer: 1:7500 Click image to enlarge

CPTC-S100A4-3 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-S100A4-3 for NCI60 Cell Line Array
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Titer: 1:7500


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-S100A4-3. Titer: 1:7500 Click image to enlarge

CPTC-S100A4-3 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-S100A4-3. Titer: 1:7500


  IPMS
Download This PDF contains the spectra and recommendation for use of this antibody in immuno capture mass spectrometry. (202.1 KB)

CPTC-S100A4-3 Immuno-MS

Result: Positive

This PDF contains the spectra and recommendation for use of this antibody in immuno capture mass spectrometry.


  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-S100A4-3 Click image to enlarge

CPTC-S100A4-3 Indirect ELISA

Result: Positive

Indirect ELISA of CPTC-S100A4-3


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-S100A4-3  is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-S100A4-3 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-S100A4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot Using CPTC-S100A4-3 as primary Ab against Ag 10337(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-S100A4-3 Western Blot

Result: Positive

Western Blot Using CPTC-S100A4-3 as primary Ab against Ag 10337(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).


Background

NCI Identification Number:

10337

Antigen Name:

Metastasin 100 calcium-binding protein A4 (Calvasculin)

CPTC Name:

CPTC-S100A4

Keywords:

S100A4; 18A2; 42A; CAPL; Calvasculin; FSP1; MTS1; Metastasin; OTTHUMP00000015467; OTTHUMP00000015468; OTTHUMP00000015469; OTTHUMP00000032895; P9KA; PEL98

Function:

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Chromosomal Localization:

1q21

Expression System:

E. Coli

NCBI Accession Number:

M80563

Swiss Prot Accession Number:

P26447

DNA Source:

HIP:HsCD00004965

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

3105

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLG
KRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQ
PRKK

Native Sequence:

MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRT
DEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRK
K

Calculated Isoelectric Point:

5.84

Molecular Weight:

12001

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10337 with molecular weight standards
Click image to enlarge

Ag 10337

PAGE of Ag 10337 with molecular weight standards

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com