Metastasin 100 calcium-binding protein A4 (Calvasculin)


Background

Catalog Number:

CPTC-S100A4-1

Target Antigen:

Metastasin 100 calcium-binding protein A4 (Calvasculin)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

01/24/2012

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot Using CPTC-S100A4-1 as primary Ab against Ag 10337(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-S100A4-1 Western Blot

Western Blot Using CPTC-S100A4-1 as primary Ab against Ag 10337(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-S100A4-1 Click image to enlarge

CPTC-S100A4-1 Indirect ELISA

Indirect ELISA of CPTC-S100A4-1

  NCI 60 Protein Array
Click to enlarge image Protein Array in which S100A4-1 is screen agains the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Click image to enlarge

CPTC-S100A4-1 NCI60 Protein Array

Protein Array in which S100A4-1 is screen agains the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.

  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-S100A4-1 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:15000 Click image to enlarge

CPTC-S100A4-1 IHC NCI60

Immunohistochemistry of CPTC-S100A4-1 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:15000

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-S100A4-1. Titer: 1:15000 Click image to enlarge

CPTC-S100A4-1 IHC Tissue

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-S100A4-1. Titer: 1:15000

  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for S100A4-1 Ab (635A8.1) using Biacore SPR method Click image to enlarge

CPTC-S100A4-1 SPR

Kinetic titration data for S100A4-1 Ab (635A8.1) using Biacore SPR method

  IPMS
Download S100A4-1.pdf (200.3 KB)

CPTC-S100A4-1 Immuno MS

This PDF contains the spectra and recommendation for use of this antibody in immuno capture mass spectrometry.

Background

Catalog Number:

CPTC-S100A4-2

Target Antigen:

Metastasin 100 calcium-binding protein A4 (Calvasculin)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

01/24/2012

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot Using CPTC-S100A4-2 as primary Ab against Ag 10337(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-S100A4-2 Western Blot

Western Blot Using CPTC-S100A4-2 as primary Ab against Ag 10337(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-S100A4-2 Click image to enlarge

CPTC-S100A4-2 Indirect ELISA

Indirect ELISA of CPTC-S100A4-2

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-S100A4-2 NCI60 Protein Assay

Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-S100A4-2 for NCI60  Cell Line Array at titer 1:8000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-S100A4-2 IHC NCI60

Immuno-histochemistry of CPTC-S100A4-2 for NCI60 Cell Line Array at titer 1:8000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-S100A4-2. Titer: 1:8000 Click image to enlarge

CPTC-S100A4-2 IHC Tissue

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-S100A4-2. Titer: 1:8000

  IHC HPA
Download S100A4-2 HPA Report.pdf (558.4 KB)

CPTC-S100A4-2 evaluation by the Human Protein Atlas

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).

  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for S100A4-2 Ab (635A11.1) using Biacore SPR method Click image to enlarge

CPTC-S100A4-2 SPR

Kinetic titration data for S100A4-2 Ab (635A11.1) using Biacore SPR method

  IPMS
Download S100A4-2.pdf (199.1 KB)

CPTC-S100A4-2 Immuno-MS

This PDF contains the spectra and recommendation for use of this antibody in immuno capture mass spectrometry.

Background

Catalog Number:

CPTC-S100A4-3

Target Antigen:

Metastasin 100 calcium-binding protein A4 (Calvasculin)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot Using CPTC-S100A4-3 as primary Ab against Ag 10337(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-S100A4-3 Western Blot

Western Blot Using CPTC-S100A4-3 as primary Ab against Ag 10337(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-S100A4-3 Click image to enlarge

CPTC-S100A4-3 Indirect ELISA

Indirect ELISA of CPTC-S100A4-3

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-S100A4-3  is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-S100A4-3 NCI 60 Protein Array

Protein Array in which CPTC-S100A4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-S100A4-3 for NCI60  Cell Line Array
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Titer: 1:7500 Click image to enlarge

CPTC-S100A4-3 IHC NCI60

Immuno-histochemistry of CPTC-S100A4-3 for NCI60 Cell Line Array
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Titer: 1:7500

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-S100A4-3. Titer: 1:7500 Click image to enlarge

CPTC-S100A4-3 IHC Tissue

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-S100A4-3. Titer: 1:7500

  IHC HPA
Download S100A4-3 HPA Report.pdf (161.4 KB)

CPTC-S100A4-3 evaluation by the Human Protein Atlas

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).

  IHC HPA
Download CPTC-S100A4-3.pdf (107.0 KB)

CPTC-S100A4-3 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for S100A4-3 Ab (635A23.1) using Biacore SPR method Click image to enlarge

CPTC-S100A4-3 SPR

Kinetic titration data for S100A4-3 Ab (635A23.1) using Biacore SPR method

  IPMS
Download S100A4-3.pdf (202.1 KB)

CPTC-S100A4-3 Immuno-MS

This PDF contains the spectra and recommendation for use of this antibody in immuno capture mass spectrometry.

Background

NCI Identification Number:

10337

Antigen Name:

Metastasin 100 calcium-binding protein A4 (Calvasculin)

CPTC Name:

CPTC-S100A4

Keywords:

S100A4; 18A2; 42A; CAPL; Calvasculin; FSP1; MTS1; Metastasin; OTTHUMP00000015467; OTTHUMP00000015468; OTTHUMP00000015469; OTTHUMP00000032895; P9KA; PEL98

Function:

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Chromosomal Localization:

1q21

Expression System:

E. Coli

NCBI Accession Number:

M80563

Swiss Prot Accession Number:

P26447

DNA Source:

HIP:HsCD00004965

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

3105

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLG
KRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQ
PRKK

Native Sequence:

MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRT
DEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRK
K

Calculated Isoelectric Point:

5.84

Molecular Weight:

12001

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Kinetic titration data for S100A4-3 Ab (635A23.1) using Biacore SPR method
Click image to enlarge

Ag 10337

PAGE of Ag 10337 with molecular weight standards

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com