Receptor Like Tyrosine Kinase Peptide 1


Background

Catalog Number:

CPTC-RYK-1

Target Antigen:

Receptor Like Tyrosine Kinase Peptide 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

05/15/2025

Antigen Recognition(s):

Peptide, Endogenous

External Links
Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry
Click to enlarge image The affinity and binding kinetics of CPTC-RYK-1 and BSA-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B) were measured using biolayer interferometry. CPTC-RYK-1 antibody was covalently immobilized onto amine-reactive second-generation biosensors (AR2G). For (A), BSA-conjugated peptide “PAP”, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. For (B), BSA-conjugated peptide “SET”, 16 nM, 4 nM, 1 nM and 0.25 nM, was used as analyte.  Buffer only and biosensors immobilized with BSA alone were used as references for background subtraction. Click image to enlarge

CPTC-RYK-1 Affinity and Kinetics (BLI)

Result: High Binding

The affinity and binding kinetics of CPTC-RYK-1 and BSA-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B) were measured using biolayer interferometry. CPTC-RYK-1 antibody was covalently immobilized onto amine-reactive second-generation biosensors (AR2G). For (A), BSA-conjugated peptide “PAP”, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. For (B), BSA-conjugated peptide “SET”, 16 nM, 4 nM, 1 nM and 0.25 nM, was used as analyte. Buffer only and biosensors immobilized with BSA alone were used as references for background subtraction.


  Affinity Measurement by SPR
Click to enlarge image Affinity and binding kinetics of CPTC-RYK-1 and KLH-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and KLH-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B) were measured using surface plasmon resonance. For (A), CPTC-RYK-1 was amine coupled onto a Series S CM5 biosensor chip.  KLH-conjugated peptide “PAP”, 1024 nM, 256 nM, 64 nM, 16 nM, and 4 nM, was used as analyte. Kinetic constants were difficult to determine. For (B), KLH-conjugated peptide “SET” was amine coupled to a Series S CM5 biosensor ship. RYK-1 antibody, 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte.   Binding data were double-referenced and analyzed globally. Click image to enlarge

CPTC-RYK-1 Affinity and Kinetics (SPR)

Result: High Binding

Affinity and binding kinetics of CPTC-RYK-1 and KLH-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and KLH-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B) were measured using surface plasmon resonance. For (A), CPTC-RYK-1 was amine coupled onto a Series S CM5 biosensor chip. KLH-conjugated peptide “PAP”, 1024 nM, 256 nM, 64 nM, 16 nM, and 4 nM, was used as analyte. Kinetic constants were difficult to determine. For (B), KLH-conjugated peptide “SET” was amine coupled to a Series S CM5 biosensor ship. RYK-1 antibody, 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. Binding data were double-referenced and analyzed globally.


  CyTOF
Click to enlarge image Imaging mass cytometry on colon cancer tissue core using CPTC-RYK-1 metal-labeled antibody.  Data shows overlay of target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (prostate, pancreas, and kidney) and cancer tissues (colon, lung, and ovarian). Click image to enlarge

CPTC-RYK-1 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on colon cancer tissue core using CPTC-RYK-1 metal-labeled antibody. Data shows overlay of target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (prostate, pancreas, and kidney) and cancer tissues (colon, lung, and ovarian).


  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (480.1 KB)

CPTC-RYK-1 evaluation by the Human Protein Atlas

Result: Positive

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).


  IHC Tissue
Click to enlarge image Tissue Micro-Array (TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-RYK-1. Titer: 1:500 Click image to enlarge

CPTC-RYK-1 IHC Tissue

Result: Positive

Tissue Micro-Array (TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-RYK-1. Titer: 1:500


  Immunofluorescence - HPA
Download Results provided by the Human Protein Atlas (www.proteinatlas.org). (480.1 KB)

CPTC-RYK-1 evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org).


  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-RYK-1 as primary antibody against KLH-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and KLH-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B).  Click image to enlarge

CPTC-RYK-1 Indirect ELISA

Result: High Binding

Indirect ELISA using CPTC-RYK-1 as primary antibody against KLH-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and KLH-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B). 


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-RYK-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-RYK-1 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-RYK-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Band of predicted size in kDa (+/-20%) with additional bands present.
Analysis performed using a standard panel of samples. Antibody dilution: 1:500 Click image to enlarge

CPTC-RYK-1 evaluation by the Human Protein Atlas

Result: Presumed Positive (with additional bands)

Band of predicted size in kDa (+/-20%) with additional bands present.
Analysis performed using a standard panel of samples. Antibody dilution: 1:500


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot using CPTC-RYK-1 as primary antibody against RYK recombinant protein (lane 1), BSA conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (lane 2) and BSA conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (lane 3).  Expected molecular weight - 68 kDa (recombinant protein) and 71 kDa (peptides).  Molecular weight standards are also included. Click image to enlarge

CPTC-RYK-1 Western Blot (Recombinant Protein and Peptide)

Result: Positive

Western blot using CPTC-RYK-1 as primary antibody against RYK recombinant protein (lane 1), BSA conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (lane 2) and BSA conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (lane 3). Expected molecular weight - 68 kDa (recombinant protein) and 71 kDa (peptides). Molecular weight standards are also included.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide

CPTC-RYK-1 Automated Western Blot (Recombinant Protein)

Result: Negative

Automated western blot using CPTC-RYK-1 as primary antibody against recombinant RYK. Molecular weight standards are also included. The antibody was not able to recognize the antigen in the tested conditions.


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western blot using CPTC-RYK-1 as primary antibody against HT-29 (lane 2), Hep G2 (lane 3), MCF7 (lane 4), A549 (lane 5), HeLa (lane 6) and Jurkat (lane 7) whole cell lysates and human plasma (lane 8).  Expected molecular weight – 68 kDa.  Molecular weight standards are also included. Hep G2 and Jurkat are positive. Human plasma is presumed positive. Click image to enlarge

CPTC-RYK-1 Western Blot (Cell Lysate)

Result: Positive

Western blot using CPTC-RYK-1 as primary antibody against HT-29 (lane 2), Hep G2 (lane 3), MCF7 (lane 4), A549 (lane 5), HeLa (lane 6) and Jurkat (lane 7) whole cell lysates and human plasma (lane 8). Expected molecular weight – 68 kDa. Molecular weight standards are also included. Hep G2 and Jurkat are positive. Human plasma is presumed positive.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Automated western blot using CPTC-RYK-1 as primary antibody against HT-29, Hep G2, MCF7, A549, HeLa and Jurkat whole cell lysates.  Expected molecular weight – 68 kDa.  Molecular weight standards are also included. The antibody was not able to recognize the antigen in the tested conditions. Click image to enlarge

CPTC-RYK-1 Automated Western Blot (Cell Lysate)

Result: Negative

Automated western blot using CPTC-RYK-1 as primary antibody against HT-29, Hep G2, MCF7, A549, HeLa and Jurkat whole cell lysates. Expected molecular weight – 68 kDa. Molecular weight standards are also included. The antibody was not able to recognize the antigen in the tested conditions.


Background

Catalog Number:

CPTC-RYK-2

Target Antigen:

Receptor Like Tyrosine Kinase Peptide 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/21/2023

Antigen Recognition(s):

Peptide

Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry
Click to enlarge image The affinity and binding kinetics of CPTC-RYK-2 and BSA-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B) were measured using biolayer interferometry. CPTC-RYK-2 antibody was covalently immobilized onto amine-reactive second-generation biosensors (AR2G). For (A), BSA-conjugated peptide “PAP”, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. For (B), no binding was observed. Buffer only and biosensors immobilized with BSA alone were used as references for background subtraction. Click image to enlarge

CPTC-RYK-2 Affinity and Kinetics (BLI)

Result: High Binding

The affinity and binding kinetics of CPTC-RYK-2 and BSA-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B) were measured using biolayer interferometry. CPTC-RYK-2 antibody was covalently immobilized onto amine-reactive second-generation biosensors (AR2G). For (A), BSA-conjugated peptide “PAP”, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. For (B), no binding was observed. Buffer only and biosensors immobilized with BSA alone were used as references for background subtraction.


  Affinity Measurement by SPR
Click to enlarge image Affinity and binding kinetics of CPTC-RYK-2 and KLH-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and KLH-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B) were measured using surface plasmon resonance. For (A), CPTC-RYK-2 was amine coupled onto a Series S CM5 biosensor chip.  KLH-conjugated peptide “PAP”, 1024 nM, 256 nM, 64 nM, 16 nM, and 4 nM, was used as analyte. Kinetic constants could not be uniquely determined. For (B), KLH-conjugated peptide “SET” was amine coupled to a Series S CM5 biosensor ship. RYK-2 antibody was used as analyte.  No binding was observed. Binding data were double-referenced and analyzed globally. Click image to enlarge

CPTC-RYK-2 Affinity and Kinetics (SPR)

Result: High Binding

Affinity and binding kinetics of CPTC-RYK-2 and KLH-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and KLH-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B) were measured using surface plasmon resonance. For (A), CPTC-RYK-2 was amine coupled onto a Series S CM5 biosensor chip. KLH-conjugated peptide “PAP”, 1024 nM, 256 nM, 64 nM, 16 nM, and 4 nM, was used as analyte. Kinetic constants could not be uniquely determined. For (B), KLH-conjugated peptide “SET” was amine coupled to a Series S CM5 biosensor ship. RYK-2 antibody was used as analyte. No binding was observed. Binding data were double-referenced and analyzed globally.


  IHC HPA
Download Results provided by the Human Protein Atlas (www.proteinatlas.org). (400.3 KB)

CPTC-RYK-2 evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org).


  Immunofluorescence - HPA
Download Results provided by the Human Protein Atlas (www.proteinatlas.org). (400.3 KB)

CPTC-RYK-2 evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org).


  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-RYK-2 as primary antibody against KLH-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and KLH-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B).  Click image to enlarge

CPTC-RYK-2 Indirect ELISA

Result: High Binding

Indirect ELISA using CPTC-RYK-2 as primary antibody against KLH-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and KLH-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B). 


Characterization SOP Files

  NCI 60 Protein Array

CPTC-RYK-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot using CPTC-RYK-2 as primary antibody against RYK recombinant protein (lane 1), BSA conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (lane 2) and BSA conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (lane 3).  Expected molecular weight - 68 kDa (recombinant protein) and 71 kDa (peptides).  Molecular weight standards are also included. Click image to enlarge

CPTC-RYK-2 Western Blot (Recombinant Protein and Peptide)

Result: Positive

Western blot using CPTC-RYK-2 as primary antibody against RYK recombinant protein (lane 1), BSA conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (lane 2) and BSA conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (lane 3). Expected molecular weight - 68 kDa (recombinant protein) and 71 kDa (peptides). Molecular weight standards are also included.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide

CPTC-RYK-2 Automated Western Blot (Recombinant Protein)

Result: Negative

Automated western blot using CPTC-RYK-2 as primary antibody against recombinant RYK. Molecular weight standards are also included. The antibody was not able to recognize the antigen in the tested conditions.


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western blot using CPTC-RYK-2 as primary antibody against HT-29 (lane 2), Hep G2 (lane 3), MCF7 (lane 4), A549 (lane 5), HeLa (lane 6) and Jurkat (lane 7) whole cell lysates and human plasma (lane 8).  Expected molecular weight – 68 kDa.  Molecular weight standards are also included (lane 1). Human plasma is presumed positive. Click image to enlarge

CPTC-RYK-2 Western Blot (Cell Lysate)

Result: Presumed Positive (with additional bands)

Western blot using CPTC-RYK-2 as primary antibody against HT-29 (lane 2), Hep G2 (lane 3), MCF7 (lane 4), A549 (lane 5), HeLa (lane 6) and Jurkat (lane 7) whole cell lysates and human plasma (lane 8). Expected molecular weight – 68 kDa. Molecular weight standards are also included (lane 1). Human plasma is presumed positive.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Automated western blot using CPTC-RYK-2 as primary antibody against HT-29, Hep G2, MCF7, A549, HeLa and Jurkat whole cell lysates.  Expected molecular weight – 68 kDa.  Molecular weight standards are also included. The antibody was not able to recognize the antigen in the tested conditions. Click image to enlarge

CPTC-RYK-2 Automated Western Blot (Cell Lysate)

Result: Negative

Automated western blot using CPTC-RYK-2 as primary antibody against HT-29, Hep G2, MCF7, A549, HeLa and Jurkat whole cell lysates. Expected molecular weight – 68 kDa. Molecular weight standards are also included. The antibody was not able to recognize the antigen in the tested conditions.


Background

Catalog Number:

CPTC-RYK-3

Target Antigen:

Receptor Like Tyrosine Kinase Peptide 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/21/2023

Antigen Recognition(s):

Peptide, Endogenous

Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry
Click to enlarge image The affinity and binding kinetics of CPTC-RYK-3 and BSA-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and BSA-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B) were measured using biolayer interferometry. CPTC-RYK-3 antibody was covalently immobilized onto amine-reactive second-generation biosensors (AR2G). For (A), BSA-conjugated peptide “PAP”, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. For (B), no binding was observed. Buffer only and biosensors immobilized with BSA alone were used as references for background subtraction. Click image to enlarge

CPTC-RYK-3 Affinity and Kinetics (BLI)

Result: High Binding

The affinity and binding kinetics of CPTC-RYK-3 and BSA-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and BSA-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B) were measured using biolayer interferometry. CPTC-RYK-3 antibody was covalently immobilized onto amine-reactive second-generation biosensors (AR2G). For (A), BSA-conjugated peptide “PAP”, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. For (B), no binding was observed. Buffer only and biosensors immobilized with BSA alone were used as references for background subtraction.


  Affinity Measurement by SPR
Click to enlarge image Affinity and binding kinetics of CPTC-RYK-3 and KLH-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and KLH-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B) were measured using surface plasmon resonance. For (A), CPTC-RYK-3 was amine coupled onto a Series S CM5 biosensor chip.  KLH-conjugated peptide “PAP”, 1024 nM, 256 nM, 64 nM, 16 nM, and 4 nM, was used as analyte. Kinetic constants could not be uniquely determined. For (B), KLH-conjugated peptide “SET” was amine coupled to a Series S CM5 biosensor ship. RYK-3 antibody was used as analyte.  No binding was observed. Binding data were double-referenced and analyzed globally. Click image to enlarge

CPTC-RYK-3 Affinity and Kinetics (SPR)

Result: High Binding

Affinity and binding kinetics of CPTC-RYK-3 and KLH-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and KLH-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B) were measured using surface plasmon resonance. For (A), CPTC-RYK-3 was amine coupled onto a Series S CM5 biosensor chip. KLH-conjugated peptide “PAP”, 1024 nM, 256 nM, 64 nM, 16 nM, and 4 nM, was used as analyte. Kinetic constants could not be uniquely determined. For (B), KLH-conjugated peptide “SET” was amine coupled to a Series S CM5 biosensor ship. RYK-3 antibody was used as analyte. No binding was observed. Binding data were double-referenced and analyzed globally.


  IHC HPA
Download Results provided by the Human Protein Atlas (www.proteinatlas.org). (442.9 KB)

CPTC-RYK-3 evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org).


  Immunofluorescence - HPA
Download Results provided by the Human Protein Atlas (www.proteinatlas.org). (442.9 KB)

CPTC-RYK-3 evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org).


  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-RYK-3 as primary antibody against KLH-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and KLH-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B). Click image to enlarge

CPTC-RYK-3 Indirect ELISA

Result: High Binding

Indirect ELISA using CPTC-RYK-3 as primary antibody against KLH-conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (A) and KLH-conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (B).


Characterization SOP Files

  NCI 60 Protein Array

CPTC-RYK-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot using CPTC-RYK-3 as primary antibody against RYK recombinant protein (lane 1), BSA conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (lane 2) and BSA conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (lane 3).  Expected molecular weight - 68 kDa (recombinant protein) and 71 kDa (peptides).  Molecular weight standards are also included. Click image to enlarge

CPTC-RYK-3 Western Blot (Recombinant Protein and Peptide)

Result: Positive

Western blot using CPTC-RYK-3 as primary antibody against RYK recombinant protein (lane 1), BSA conjugated peptide “PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC” (lane 2) and BSA conjugated peptide “SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQV” (lane 3). Expected molecular weight - 68 kDa (recombinant protein) and 71 kDa (peptides). Molecular weight standards are also included.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide

CPTC-RYK-3 Automated Western Blot (Recombinant Protein)

Result: Negative

Automated western blot using CPTC-RYK-3 as primary antibody against recombinant RYK. Molecular weight standards are also included. The antibody was not able to recognize the antigen in the tested conditions.


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western blot using CPTC-RYK-3 as primary antibody against HT-29 (lane 2), Hep G2 (lane 3), MCF7 (lane 4), A549 (lane 5), HeLa (lane 6) and Jurkat (lane 7) whole cell lysates and human plasma (lane 8).  Expected molecular weight – 68 kDa.  Molecular weight standards are also included (lane 1).  Human plasma is presumed positive. Click image to enlarge

CPTC-RYK-3 Western Blot (Cell Lysate)

Result: Presumed Positive (with additional bands)

Western blot using CPTC-RYK-3 as primary antibody against HT-29 (lane 2), Hep G2 (lane 3), MCF7 (lane 4), A549 (lane 5), HeLa (lane 6) and Jurkat (lane 7) whole cell lysates and human plasma (lane 8). Expected molecular weight – 68 kDa. Molecular weight standards are also included (lane 1). Human plasma is presumed positive.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Automated western blot using CPTC-RYK-3 as primary antibody against HT-29, Hep G2, MCF7, A549, HeLa and Jurkat whole cell lysates.  Expected molecular weight – 68 kDa.  Molecular weight standards are also included. The antibody was able to recognize the antigen in the tested cell lysates. Click image to enlarge

CPTC-RYK-3 Automated Western Blot (Cell Lysate)

Result: Positive

Automated western blot using CPTC-RYK-3 as primary antibody against HT-29, Hep G2, MCF7, A549, HeLa and Jurkat whole cell lysates. Expected molecular weight – 68 kDa. Molecular weight standards are also included. The antibody was able to recognize the antigen in the tested cell lysates.


Background

NCI Identification Number:

00504

Antigen Name:

Receptor Like Tyrosine Kinase Peptide 1

CPTC Name:

CPTC-RYK Peptide 1

Aliases:

Receptor Like Tyrosine Kinase; D3S3195; JTK5A; RYK1; JTK5; JTK5A Protein Tyrosine Kinase; Tyrosine-Protein Kinase RYK; EC 2.7.10.1; RYK Receptor-Like Tyrosine Kinase; Hydroxyaryl-Protein Kinase; EC 2.7.10

Function:

The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. The encoded protein has a leucine-rich extracellular domain with a WIF-type Wnt binding region, a single transmembrane domain, and an intracellular tyrosine kinase domain. This protein is involved in stimulating Wnt signaling pathways such as the regulation of axon pathfinding. Alternative splicing results in multiple transcript variants encoding distinct isoforms.RYK (Receptor Like Tyrosine Kinase) is a Protein Coding gene. Diseases associated with RYK include Atypical Chronic Myeloid Leukemia and Robinow Syndrome. Among its related pathways are Actin Nucleation by ARP-WASP Complex and ERK Signaling. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is MERTK.May be a coreceptor along with FZD8 of Wnt proteins, such as WNT1, WNT3, WNT3A and WNT5A. Involved in neuron differentiation, axon guidance, corpus callosum establishment and neurite outgrowth. In response to WNT3 stimulation, receptor C-terminal cleavage occurs in its transmembrane region and allows the C-terminal intracellular product to translocate from the cytoplasm to the nucleus where it plays a crucial role in neuronal development.

Chromosomal Localization:

3q22.2

Accession Number:

NP_001005861.1

UniProt Accession Number:

P34925

DNA Source:

N/A

Immunogen:

Synthetic Peptide

Vector Name:

N/A

Extinction Coefficient:

Buffers:

Expressed Sequence:

PAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRC, SETNFL
HFTWHAKSKVEYKLGFQVDNVLAMDMPQVC

Native Sequence:

Calculated Isoelectric Point:

Molecular Weight:

4

Last Updated:

02/17/2022

Links

Characterization Data

SOPs

No SOPs available.

Don't have Adobe Reader™?

Get it for free at Adobe.com