Malate dehydrogenase 1 NAD (soluble)


Background

Catalog Number:

CPTC-MDH1-1

Target Antigen:

Malate dehydrogenase 1 NAD (soluble)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MDH1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-MDH1-1 as primary Ab against Ag 10990 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MDH1-1 Western blot

Western Blot using CPTC-MDH1-1 as primary Ab against Ag 10990 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-MDH1-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MDH1 (NCI 10990) in (lane 4). Click image to enlarge

CPTC-MDH1-1 Cell Lysate Western blot

Western Blot using CPTC-MDH1-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MDH1 (NCI 10990) in (lane 4).

  NCI 60 Protein Array

CPTC-MDH1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC Tissue

CPTC-MDH1-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC NCI60

CPTC-MDH1-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (100.9 KB)

CPTC-MDH1-1

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-MDH1-2

Target Antigen:

Malate dehydrogenase 1 NAD (soluble)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MDH1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-MDH1-2 as primary Ab against Ag 10990 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MDH1-2 Western blot

Western Blot using CPTC-MDH1-2 as primary Ab against Ag 10990 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-MDH1-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MDH1 (NCI 10990) in (lane 4). Click image to enlarge

CPTC-MDH1-2 Cell Lysate Western blot

Western Blot using CPTC-MDH1-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MDH1 (NCI 10990) in (lane 4).

  NCI 60 Protein Array

CPTC-MDH1-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC Tissue

CPTC-MDH1-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC NCI60

CPTC-MDH1-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (89.7 KB)

CPTC-MDH1-2 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-MDH1-3

Target Antigen:

Malate dehydrogenase 1 NAD (soluble)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MDH1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-MDH1-3 as primary Ab against Ag 10990 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MDH1-3 Western blot

Western Blot using CPTC-MDH1-3 as primary Ab against Ag 10990 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-MDH1-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MDH1 (NCI 10990) in (lane 4). Click image to enlarge

CPTC-MDH1-3 Cell Lysate Western blot

Western Blot using CPTC-MDH1-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MDH1 (NCI 10990) in (lane 4).

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MDH1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-MDH1-3 Protein Array

Protein Array in which CPTC-MDH1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (92.6 KB)

CPTC-MDH1-3 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

NCI Identification Number:

10990

Antigen Name:

Malate dehydrogenase 1 NAD (soluble)

CPTC Name:

CPTC-MDH1

Keywords:

EC 1.1.1.37; MDH-s; MDHA; MGC:1375; MOR2

Function:

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.

Chromosomal Localization:

2p13.3

Expression System:

E. Coli

NCBI Accession Number:

BC001484.2

Swiss Prot Accession Number:

P40925

DNA Source:

OB : MHS1011-169973

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

32555

Buffers:

PBS

Expressed Sequence:

SNAMSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMM
GVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGME
RKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSI
PKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNH
AKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAA
KAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTW
KFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

Native Sequence:

MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVL
DGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKD
LLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKE
NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV
KLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAI
CDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFV
EGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

Calculated Isoelectric Point:

6.91

Molecular Weight:

36.43

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image PAGE of MDH1 (Ag 10990) in Lane 2 with molecular weight standards in lane 1
Click image to enlarge

CPTC-MDH1 PAGE

PAGE of MDH1 (Ag 10990) in Lane 2 with molecular weight standards in lane 1

No SOPs available.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com