PRINT

Solute Carrier Family 27 Member 3

Antibody: CPTC-SLC27A3-1
Background

Catalog Number:

CPTC-SLC27A3-1

Target Antigen:

Solute Carrier Family 27 Member 3

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

12/06/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
Characterization Data [Compare Characterization Data]
  Flow Cytometry
Click to enlarge image Flow cytometric analysis of Long-chain fatty acid transport protein 3 (SLC27A3) expression using CPTC-SLC27A3-1 mouse monoclonal antibody. MALME-3M cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-1 (solid green) or concentration-matched mouse isotype control (dashed green) antibodies. OVCAR8 cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-1 (solid blue) or concentration-matched rabbit isotype control (dashed blue) antibodies. A BV421 conjugated goat anti-mouse IgG was used as a secondary antibody. All data were analyzed using FlowJo. Click image to enlarge

CPTC-SLC27A3-1 (Flow Cytometry)

Result: Positive

Flow cytometric analysis of Long-chain fatty acid transport protein 3 (SLC27A3) expression using CPTC-SLC27A3-1 mouse monoclonal antibody. MALME-3M cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-1 (solid green) or concentration-matched mouse isotype control (dashed green) antibodies. OVCAR8 cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-1 (solid blue) or concentration-matched rabbit isotype control (dashed blue) antibodies. A BV421 conjugated goat anti-mouse IgG was used as a secondary antibody. All data were analyzed using FlowJo.


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-SLC27A3-1 as primary Ab against SLC27A3 HEK293T cell transient overexpression lysate (lane 2). Also included are molecular wt. standards Click image to enlarge

CPTC-SLC27A3-1 Over-expressed Cell Lysate Western Blot

Result: Positive

Western Blot using CPTC-SLC27A3-1 as primary Ab against SLC27A3 HEK293T cell transient overexpression lysate (lane 2). Also included are molecular wt. standards


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-SLC27A3-1 as primary Ab against U87 lysate (lane 2). Also included are molecular wt. standards. Click image to enlarge

CPTC-SLC27A3-1 Cell Lysate Western Blot

Result: Positive

Western Blot using CPTC-SLC27A3-1 as primary Ab against U87 lysate (lane 2). Also included are molecular wt. standards.


Characterization SOP Files

[top]

Antibody: CPTC-SLC27A3-2
Background

Catalog Number:

CPTC-SLC27A3-2

Target Antigen:

Solute Carrier Family 27 Member 3

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

12/06/2024

Antigen Recognition(s):

Recombinant Full-length

Purchase
Characterization Data [Compare Characterization Data]
  Flow Cytometry
Click to enlarge image Flow cytometric analysis of Long-chain fatty acid transport protein 3 (SLC27A3) expression using CPTC-SLC27A3-2 mouse monoclonal antibody. MALME-3M cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-2 (solid green) or concentration-matched mouse isotype control (dashed green) antibodies. OVCAR8 cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-2 (solid blue) or concentration-matched mouse isotype control (dashed blue) antibodies. A BV421 conjugated goat anti-mouse IgG was used as a secondary antibody. All data were analyzed using FlowJo. Click image to enlarge

CPTC-SLC27A3-2 (Flow Cytometry)

Result: Positive

Flow cytometric analysis of Long-chain fatty acid transport protein 3 (SLC27A3) expression using CPTC-SLC27A3-2 mouse monoclonal antibody. MALME-3M cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-2 (solid green) or concentration-matched mouse isotype control (dashed green) antibodies. OVCAR8 cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-2 (solid blue) or concentration-matched mouse isotype control (dashed blue) antibodies. A BV421 conjugated goat anti-mouse IgG was used as a secondary antibody. All data were analyzed using FlowJo.


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-SLC27A3-2 as primary Ab against SLC27A3 HEK293T cell transient overexpression lysate (lane 2). Also included are molecular wt. standards. This antibody is not suitable in this application in the described conditions. Click image to enlarge

CPTC-SLC27A3-2 Overexpressed Lysate Western Blot

Result: Positive

Western Blot using CPTC-SLC27A3-2 as primary Ab against SLC27A3 HEK293T cell transient overexpression lysate (lane 2). Also included are molecular wt. standards.
This antibody is not suitable in this application in the described conditions.


Characterization SOP Files

[top]

Antibody: CPTC-SLC27A3-3
Background

Catalog Number:

CPTC-SLC27A3-3

Target Antigen:

Solute Carrier Family 27 Member 3

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

12/06/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
Characterization Data [Compare Characterization Data]
  Flow Cytometry
Click to enlarge image Flow cytometric analysis of Long-chain fatty acid transport protein 3 (SLC27A3) expression using CPTC-SLC27A3-3 mouse monoclonal antibody. MALME-3M cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-3 (solid green) or concentration-matched mouse isotype control (dashed green) antibodies. OVCAR8 cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-3 (solid blue) or concentration-matched mouse isotype control (dashed blue) antibodies. A BV421 conjugated goat anti-mouse IgG was used as a secondary antibody. All data were analyzed using FlowJo. Click image to enlarge

CPTC-SLC27A3-3 (Flow Cytometry)

Result: Positive

Flow cytometric analysis of Long-chain fatty acid transport protein 3 (SLC27A3) expression using CPTC-SLC27A3-3 mouse monoclonal antibody. MALME-3M cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-3 (solid green) or concentration-matched mouse isotype control (dashed green) antibodies. OVCAR8 cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-3 (solid blue) or concentration-matched mouse isotype control (dashed blue) antibodies. A BV421 conjugated goat anti-mouse IgG was used as a secondary antibody. All data were analyzed using FlowJo.


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-SLC27A3-3 as primary Ab against SLC27A3 HEK293T cell transient overexpression lysate (lane 2). Also included are molecular wt. standards. Click image to enlarge

CPTC-SLC27A3-3 Cell Lysate Western Blot

Result: Positive

Western Blot using CPTC-SLC27A3-3 as primary Ab against SLC27A3 HEK293T cell transient overexpression lysate (lane 2). Also included are molecular wt. standards.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-SLC27A3-3 as primary Ab against U87 lysate (lane 2). Also included are molecular wt. standards. Click image to enlarge

CPTC-SLC27A3-3 Cell Lysate Western Blot

Result: Positive

Western Blot using CPTC-SLC27A3-3 as primary Ab against U87 lysate (lane 2). Also included are molecular wt. standards.


Characterization SOP Files

[top]

Antibody: CPTC-SLC27A3-4
Background

Catalog Number:

CPTC-SLC27A3-4

Target Antigen:

Solute Carrier Family 27 Member 3

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

12/06/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
Characterization Data [Compare Characterization Data]
  Flow Cytometry
Click to enlarge image Flow cytometric analysis of Long-chain fatty acid transport protein 3 (SLC27A3) expression using CPTC-SLC27A3-4 mouse antibody. MALME-3M cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-4 (solid green) or concentration-matched mouse isotype control (dashed green) antibodies. OVCAR8 cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-4 (solid blue) or concentration-matched mouse isotype control (dashed blue) antibodies. A BV421 conjugated goat anti-mouse IgG was used as a secondary antibody. All data were analyzed using FlowJo. Click image to enlarge

CPTC-SLC27A3-4 (Flow Cytometry)

Result: Positive

Flow cytometric analysis of Long-chain fatty acid transport protein 3 (SLC27A3) expression using CPTC-SLC27A3-4 mouse antibody. MALME-3M cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-4 (solid green) or concentration-matched mouse isotype control (dashed green) antibodies. OVCAR8 cells were fixed, permeabilized, and then stained with CPTC-SLC27A3-4 (solid blue) or concentration-matched mouse isotype control (dashed blue) antibodies. A BV421 conjugated goat anti-mouse IgG was used as a secondary antibody. All data were analyzed using FlowJo.


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-SLC27A3-4 as primary Ab against SLC27A3 HEK293T cell transient overexpression lysate (lane 2). Also included are molecular wt. standards. Click image to enlarge

CPTC-SLC27A3-4 Over-expressed Cell Lysate Western Blot

Result: Positive

Western Blot using CPTC-SLC27A3-4 as primary Ab against SLC27A3 HEK293T cell transient overexpression lysate (lane 2). Also included are molecular wt. standards.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-SLC27A3-4 as primary Ab against U87 lysate (lane 2). Also included are molecular wt. standards. Click image to enlarge

CPTC-SLC27A3-4 Cell Lysate Western Blot

Result: Positive

Western Blot using CPTC-SLC27A3-4 as primary Ab against U87 lysate (lane 2). Also included are molecular wt. standards.


Characterization SOP Files

[top]

Antigen: Solute Carrier Family 27 Member 3
Background

NCI Identification Number:

00270

Antigen Name:

Solute Carrier Family 27 Member 3

CPTC Name:

CPTC-SLC27A3

Aliases:

Solute Carrier Family 27 Member 3; Solute Carrier Family 27 (Fatty Acid Transporter), Member 3; Very Long-Chain Acyl-CoA Synthetase Homolog 3; ACSVL3; VLCS-3; FATP3; Long-Chain Fatty Acid Transport Protein 3; Fatty Acid Transport Protein 3; EC 6.2.1.-; FATP-3

Function:

This gene belongs to a family of integral membrane proteins and encodes a protein that is involved in lipid metabolism. The increased expression of this gene in human neural stem cells derived from induced pluripotent stem cells suggests that it plays an important role in early brain development. Naturally occurring mutations in this gene are associated with autism spectrum disorders. Alternative splicing results in multiple transcript variants.

SLC27A3 (Solute Carrier Family 27 Member 3) is a Protein Coding gene. Diseases associated with SLC27A3 include Autism. Among its related pathways are Fatty Acyl-CoA Biosynthesis and Metabolism. Gene Ontology (GO) annotations related to this gene include nucleotide binding and long-chain fatty acid-CoA ligase activity. An important paralog of this gene is SLC27A6.

Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids. Does not exhibit fatty acid transport activity (By similarity).

Chromosomal Localization:

1q21.3

Expression System:

E.coli

Accession Number:

NP_001304858.3

UniProt Accession Number:

Q5K4L6

DNA Source:

N/A

Immunogen:

Recombinant Domain

Vector Name:

pGEX-5x and pMal-C2

Extinction Coefficient:

Buffers:

Expressed Sequence:

QGKLLKDVFRPGDVFFNTGDLLVCDDQGFLRFHDRTGDTFRWKGENVATT
EVAEVFEALDFLQEVNVYGVTVPGHEGRAGMAALVLRPPHALDLMQLYTH
VSENLPPYARPRFLRLQESLATTETFKQQKVRMANEGFDPSTLSDPLYVL
DQAVGAYLPLTTARYSALLAGNLRI

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

19589

Last Updated:

08/17/2018

Links

Characterization Data

SOPs

No SOPs available.

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]