PRINT

Yes1 Associated Transcriptional Regulator (mouse)

Antibody: CPTC-YAP1-1
Background

Catalog Number:

CPTC-YAP1-1

Target Antigen:

Yes1 Associated Transcriptional Regulator (mouse)

Isotype:

IgG

Species:

Rabbit Monoclonal Antibody

Last Updated:

03/12/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry
Click to enlarge image Affinity and binding kinetics of CPTC-YAP1-1 and mouse YAP1 full length recombinant protein were measured using biolayer interferometry. Mouse YAP1 recombinant protein was amine coupled onto AR2G biosensors. CPTC-YAP1-1-rabbit antibody at 256 nM, 64 nM, 16 nM, 4 nM, 1.0 nM and 0.25 nM, was used as analyte. Buffer only and biosensors immobilized without recombinant protein were used as references for background subtraction. All data was analyzed globally using a bivalent fitting model. Click image to enlarge

CPTC-YAP1-1 Affinity and Kinetics (Bio-Layer Interferometry) 

Result: Positive

Affinity and binding kinetics of CPTC-YAP1-1 and mouse YAP1 full length recombinant protein were measured using biolayer interferometry. Mouse YAP1 recombinant protein was amine coupled onto AR2G biosensors. CPTC-YAP1-1-rabbit antibody at 256 nM, 64 nM, 16 nM, 4 nM, 1.0 nM and 0.25 nM, was used as analyte. Buffer only and biosensors immobilized without recombinant protein were used as references for background subtraction. All data was analyzed globally using a bivalent fitting model.


Characterization SOP Files

  Affinity Measurement by SPR
Click to enlarge image Affinity and binding kinetics of CPTC-YAP1-1 and mouse YAP1 full length recombinant protein were measured using surface plasmon resonance. Mouse YAP1 full length recombinant protein was amine coupled onto a Series S CM5 biosensor chip. CPTC-YAP1-1 rabbit antibody at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, 0.25 nM, and 0.0625nM was used as analyte. All data were double referenced and analyzed globally using a bivalent fitting model. Click image to enlarge

CPTC-YAP1-1 Affinity and Kinetics (Surface Plasmon Resonance)

Result: Positive

Affinity and binding kinetics of CPTC-YAP1-1 and mouse YAP1 full length recombinant protein were measured using surface plasmon resonance. Mouse YAP1 full length recombinant protein was amine coupled onto a Series S CM5 biosensor chip. CPTC-YAP1-1 rabbit antibody at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, 0.25 nM, and 0.0625nM was used as analyte. All data were double referenced and analyzed globally using a bivalent fitting model.


Characterization SOP Files

  Flow Cytometry
Click to enlarge image Flow cytometric analysis of YAP1 expression in SF-268 and A549 cells using CPTC-YAP1-1 rabbit antibody. SF-268 cells were permeabilized and fixed and then stained with CPTC-YAP1-1 antibody (solid green) or concentration-matched rabbit isotype control antibody (dashed green). A549 cells were permeabilized and fixed and then stained with CPTC-YAP1-1 (solid blue) or concentration-matched rabbit isotype control antibody (dashed blue) and then fixed. An APC conjugated goat anti-rabbit IgG (H+L) was used as a secondary antibody. All data were analyzed using FlowJo. CPTC-YAP1-1 antibody can detect expression of YAP1 in both SF-268 and A549 cells. Click image to enlarge

CPTC-YAP1-1 (Flow Cytometry)

Result: Positive

Flow cytometric analysis of YAP1 expression in SF-268 and A549 cells using CPTC-YAP1-1 rabbit antibody. SF-268 cells were permeabilized and fixed and then stained with CPTC-YAP1-1 antibody (solid green) or concentration-matched rabbit isotype control antibody (dashed green). A549 cells were permeabilized and fixed and then stained with CPTC-YAP1-1 (solid blue) or concentration-matched rabbit isotype control antibody (dashed blue) and then fixed. An APC conjugated goat anti-rabbit IgG (H+L) was used as a secondary antibody. All data were analyzed using FlowJo. CPTC-YAP1-1 antibody can detect expression of YAP1 in both SF-268 and A549 cells.


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array (TMA) core of breast cancer showing cytoplasmic and nuclear staining using Antibody CPTC-YAP1-1. Titer: 1:5000 Click image to enlarge

CPTC-YAP1-1 IHC Tissue

Result: Positive

Tissue Micro-Array (TMA) core of breast cancer showing cytoplasmic and nuclear staining using Antibody CPTC-YAP1-1. Titer: 1:5000


Characterization SOP Files

  IP
Click to enlarge image Immunoprecipitation using CPTC-YAP1-1 as capture antibody to probe whole cell lysates of SF-268, EKVX and HeLa.Eluates were tested in Simple Western, using CPTC-YAP1-1 as primary antibody (Panel A). The antibody is able to precipitate the target protein in all tested cell lysates, as also evident in the comparison between input material (blue line) and eluate (green line) profiles in panels B, C, D, respectively for SF-268, EKVX and HeLa. Click image to enlarge

CPTC-YAP1-1 IP-SW (cell lysates)

Result: Positive

Immunoprecipitation using CPTC-YAP1-1 as capture antibody to probe whole cell lysates of SF-268, EKVX and HeLa.Eluates were tested in Simple Western, using CPTC-YAP1-1 as primary antibody (Panel A). The antibody is able to precipitate the target protein in all tested cell lysates, as also evident in the comparison between input material (blue line) and eluate (green line) profiles in panels B, C, D, respectively for SF-268, EKVX and HeLa.


Characterization SOP Files

  Immunofluorescence
Click to enlarge image Immunofluorescence staining using CPTC-YAP1-1 as primary antibody (green) against A549 and SF-268 cells. A549 cells show no localization of the YAP1 protein. SF-269 show localization of the YAP1 protein in the cytoplasma and the nucleus Click image to enlarge

CPTC-YAP1-1 Immunofluorescence

Result: Positive

Immunofluorescence staining using CPTC-YAP1-1 as primary antibody (green) against A549 and SF-268 cells. A549 cells show no localization of the YAP1 protein. SF-269 show localization of the YAP1 protein in the cytoplasma and the nucleus


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-YAP1-1 as primary rabbit antibody against mouse YAP1 full length recombinant protein, coated on the plate and detected using the goat anti-rabbit antibody and TMB. Click image to enlarge

CPTC-YAP1-1 Indirect ELISA

Result: Positive

Indirect ELISA using CPTC-YAP1-1 as primary rabbit antibody against mouse YAP1 full length recombinant protein, coated on the plate and detected using the goat anti-rabbit antibody and TMB.


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-YAP1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-YAP1-1 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-YAP1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot using CPTC-YAP1-1 against YAP1 and TAZ recombinant human proteins. The antibody recognizes YAP1, and does not cross react with TAZ. Click image to enlarge

CPTC-YAP1-1 Western Blot with recombinant protein

Result: Positive

Western blot using CPTC-YAP1-1 against YAP1 and TAZ recombinant human proteins. The antibody recognizes YAP1, and does not cross react with TAZ.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western blot using CPTC-YAP1-1 as primary antibody against whole cell lysates of HeLa, MCF7, A549, SF-268 and EKVX. The target protein was detected in HeLa, MCF7, SF-268 and EKVX. The same cell lines were tested against an anti-vinculin antibody, and all the cell lines expressed the protein. Click image to enlarge

CPTC-YAP1-1 Western Blot (lysates)

Result: Positive

Western blot using CPTC-YAP1-1 as primary antibody against whole cell lysates of HeLa, MCF7, A549, SF-268 and EKVX. The target protein was detected in HeLa, MCF7, SF-268 and EKVX. The same cell lines were tested against an anti-vinculin antibody, and all the cell lines expressed the protein.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Automated WB using CPTC-YAP1-1 as primary antobody agaisnt the whole cell lysates of HeLa, MCF7, A549, SF-268 and EKVX. The antibody was able to detect the target protein in HeLa, MCF7 and SF-268. The same cell lines were also tested with an anti-vinculin antibodies, and they all express the protein. Click image to enlarge

CPTC-YAP1-1 Automated Western Blot (Lysates)

Result: Positive

Automated WB using CPTC-YAP1-1 as primary antobody agaisnt the whole cell lysates of HeLa, MCF7, A549, SF-268 and EKVX. The antibody was able to detect the target protein in HeLa, MCF7 and SF-268. The same cell lines were also tested with an anti-vinculin antibodies, and they all express the protein.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Single cell western blot using CPTC-YAP1-1 as a primary antibody against cell lysates. Relative expression of total YAP1 in A549 and SF-268 cells (A). Percentage of cells that express YAP1 (B). Average expression of YAP1 protein per cell (C). All data is normalized to β-tubulin expression. Click image to enlarge

CPTC-YAP1-1 Single Cell Western Blot (Cell Lysate)

Result: Positive

Single cell western blot using CPTC-YAP1-1 as a primary antibody against cell lysates. Relative expression of total YAP1 in A549 and SF-268 cells (A). Percentage of cells that express YAP1 (B). Average expression of YAP1 protein per cell (C). All data is normalized to β-tubulin expression.


Characterization SOP Files

[top]

Antibody: CPTC-YAP1-2
Background

Catalog Number:

CPTC-YAP1-2

Target Antigen:

Yes1 Associated Transcriptional Regulator (mouse)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/12/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry
Click to enlarge image Affinity and binding kinetics of CPTC-YAP1-2 and mouse YAP1 full length recombinant protein were measured using biolayer interferometry. Mouse YAP1 recombinant protein was amine coupled onto the AR2G biosensor. CPTC-YAP1-2 mouse antibody at 256 nM, 16 nM, 4 nM, and 0.25 nM, was used as analyte. Buffer only and biosensors immobilized without recombinant protein were used as references for background subtraction. All data was analyzed globally using a bivalent fitting model. Click image to enlarge

CPTC-YAP1-2 Affinity and Kinetics (Bio-Layer Interferometry) 

Result: Positive

Affinity and binding kinetics of CPTC-YAP1-2 and mouse YAP1 full length recombinant protein were measured using biolayer interferometry. Mouse YAP1 recombinant protein was amine coupled onto the AR2G biosensor. CPTC-YAP1-2 mouse antibody at 256 nM, 16 nM, 4 nM, and 0.25 nM, was used as analyte. Buffer only and biosensors immobilized without recombinant protein were used as references for background subtraction. All data was analyzed globally using a bivalent fitting model.


Characterization SOP Files

  Affinity Measurement by SPR
Click to enlarge image Affinity and binding kinetics of CPTC-YAP1-2 and mouse YAP1 full length recombinant protein were measured using surface plasmon resonance. Mouse YAP1 full length recombinant protein was amine coupled onto a Series S CM5 biosensor chip. CPTC-YAP1-2 mouse antibody at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, 0.25 nM, and 0.0625 nM was used as analyte. All data were double referenced and analyzed globally using a bivalent fitting model. Click image to enlarge

CPTC-YAP1-2 Affinity and Kinetics (Surface Plasmon Resonance)

Result: Positive

Affinity and binding kinetics of CPTC-YAP1-2 and mouse YAP1 full length recombinant protein were measured using surface plasmon resonance. Mouse YAP1 full length recombinant protein was amine coupled onto a Series S CM5 biosensor chip. CPTC-YAP1-2 mouse antibody at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, 0.25 nM, and 0.0625 nM was used as analyte. All data were double referenced and analyzed globally using a bivalent fitting model.


Characterization SOP Files

  Flow Cytometry
Click to enlarge image Flow cytometric analysis of YAP1 expression in SF-268 and A549 cells using CPTC-YAP1-2 mouse antibody. SF-268 cells were permeabilized and fixed and then stained with CPTC-YAP1-2 antibody (solid green) or concentration-matched mouse IgG1 isotype control antibody (dashed green). A549 cells were permeabilized and fixed and then stained with CPTC-YAP1-2 (solid blue) or concentration-matched mouse IgG1 isotype control antibody (dashed blue) and then fixed. An APC conjugated goat anti-mouse IgG (H+L) was used as a secondary antibody. All data were analyzed using FlowJo. CPTC-YAP1-2 antibody can detect expression of YAP1 in both SF-268 and A549 cells. Click image to enlarge

CPTC-YAP1-2 (Flow Cytometry)

Result: Positive

Flow cytometric analysis of YAP1 expression in SF-268 and A549 cells using CPTC-YAP1-2 mouse antibody. SF-268 cells were permeabilized and fixed and then stained with CPTC-YAP1-2 antibody (solid green) or concentration-matched mouse IgG1 isotype control antibody (dashed green). A549 cells were permeabilized and fixed and then stained with CPTC-YAP1-2 (solid blue) or concentration-matched mouse IgG1 isotype control antibody (dashed blue) and then fixed. An APC conjugated goat anti-mouse IgG (H+L) was used as a secondary antibody. All data were analyzed using FlowJo. CPTC-YAP1-2 antibody can detect expression of YAP1 in both SF-268 and A549 cells.


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array (TMA) core of breast cancer showing cytoplasmic and nuclear staining using Antibody CPTC-YAP1-2. Titer: 1:1000 Click image to enlarge

CPTC-YAP1-2 IHC Tissue

Result: Positive

Tissue Micro-Array (TMA) core of breast cancer showing cytoplasmic and nuclear staining using Antibody CPTC-YAP1-2. Titer: 1:1000


Characterization SOP Files

  IP
Click to enlarge image Immunoprecipitation using CPTC-YAP1-2 as capture antibody against rec YAP1 protein and to probe whole cell lysates of SF-268, EKVX and HeLa. Eluates were tested in Simple Western, using CPTC-YAP1-1 as primary antibody (Panel A). The antibody is able to precipitate recombinant YAP1 and target protein in all tested cell lysates, as also evident in the comparison between input material (blue line) and eluate (green line) profiles in panels B, C, D, E,respectively for rec. YAP1, SF-268, EKVX and HeLa. Click image to enlarge

CPTC-YAP1-2 IP-SW (rec. protein and cell lysates)

Result: Positive

Immunoprecipitation using CPTC-YAP1-2 as capture antibody against rec YAP1 protein and to probe whole cell lysates of SF-268, EKVX and HeLa. Eluates were tested in Simple Western, using CPTC-YAP1-1 as primary antibody (Panel A). The antibody is able to precipitate recombinant YAP1 and target protein in all tested cell lysates, as also evident in the comparison between input material (blue line) and eluate (green line) profiles in panels B, C, D, E,respectively for rec. YAP1, SF-268, EKVX and HeLa.


Characterization SOP Files

  Immunofluorescence

CPTC-YAP1-2 Immunofluorescence

Result: Negative

Immunofluorescence staining using CPTC-YAP1-2 as primary antibody against A549 and SF-268 cells show no localization of YAP1 protein.


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-YAP1-2 as primary mouse antibody against mouse YAP1 full length recombinant protein, coated on the plate and detected using the goat anti-mouse antibody and TMB. Click image to enlarge

CPTC-YAP1-2 Indirect ELISA

Result: Positive

Indirect ELISA using CPTC-YAP1-2 as primary mouse antibody against mouse YAP1 full length recombinant protein, coated on the plate and detected using the goat anti-mouse antibody and TMB.


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-YAP1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-YAP1-2 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-YAP1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western blot using CPTC-YAP1-2 as primary antibody against recombinant human and mouse YAP1 protein (MYC-tagged) in over-expressed lysates. The antibody is able to detect the target protein in both species. The same MYC-tagged proteins were also tested with an anti-MYC antibody for MW validation. Click image to enlarge

CPTC-YAP1-2 Western Blot (recombinant protein in overexpressed lysate)

Result: Positive

Western blot using CPTC-YAP1-2 as primary antibody against recombinant human and mouse YAP1 protein (MYC-tagged) in over-expressed lysates. The antibody is able to detect the target protein in both species. The same MYC-tagged proteins were also tested with an anti-MYC antibody for MW validation.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Automated WB using CPTC-YAP1-2 as primary antibody against the over-expressed lysates of human YAP1 (MYC tagged) and mouse YAP1 (MYC tagged). The antibody is able to recognize the target protein in both species (top panels). The same MYC tagged recombinant proteins in the over-expressed lysates were tested with an antibody anti-MYC, to confirm size (bottom panels). Click image to enlarge

CPTC-YAP1-2 Automated Western Blot (Over-expressed Lysates)

Result: Positive

Automated WB using CPTC-YAP1-2 as primary antibody against the over-expressed lysates of human YAP1 (MYC tagged) and mouse YAP1 (MYC tagged). The antibody is able to recognize the target protein in both species (top panels). The same MYC tagged recombinant proteins in the over-expressed lysates were tested with an antibody anti-MYC, to confirm size (bottom panels).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Automated WB using CPTC-YAP1-2 as primary antibody against the whole cell lysates of HeLa, MCF7, A549, SF-268 and EKVX. The antibody was able to detect the target protein in SF-268. The same cell lines were also tested with an anti-Cytochrome C antibodies, and they all express the protein. Click image to enlarge

CPTC-YAP1-2 Automated Western Blot (Lysates)

Result: Positive

Automated WB using CPTC-YAP1-2 as primary antibody against the whole cell lysates of HeLa, MCF7, A549, SF-268 and EKVX. The antibody was able to detect the target protein in SF-268. The same cell lines were also tested with an anti-Cytochrome C antibodies, and they all express the protein.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western blot using CPTC-YAP1-2 as primary antibody against whole lysates of HeLA, MCF7, A549, SF-268 ans EKVX. The antibody is able to detect the target protein in SF-268 adn EKVX, but also weakly in HeLa and MCF7. The same cell lines were also tested with an anti-Cytochrome C for loading control. Click image to enlarge

CPTC-YAP1-2 Western Blot (lysates)

Result: Positive

Western blot using CPTC-YAP1-2 as primary antibody against whole lysates of HeLA, MCF7, A549, SF-268 ans EKVX. The antibody is able to detect the target protein in SF-268 adn EKVX, but also weakly in HeLa and MCF7. The same cell lines were also tested with an anti-Cytochrome C for loading control.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Single cell western blot using CPTC-YAP1-2 as a primary antibody against cell lysates. Relative expression of total YAP1 in A549 and SF-268 cells (A). Percentage of cells that express YAP1 (B). Average expression of YAP1 protein per cell (C). All data is normalized to β-tubulin expression. Click image to enlarge

CPTC-YAP1-2 Single Cell Western Blot (Cell Lysate)

Result: Positive

Single cell western blot using CPTC-YAP1-2 as a primary antibody against cell lysates. Relative expression of total YAP1 in A549 and SF-268 cells (A). Percentage of cells that express YAP1 (B). Average expression of YAP1 protein per cell (C). All data is normalized to β-tubulin expression.


Characterization SOP Files

[top]

Antibody: CPTC-YAP1-3
Background

Catalog Number:

CPTC-YAP1-3

Target Antigen:

Yes1 Associated Transcriptional Regulator (mouse)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/12/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry
Click to enlarge image Affinity and binding kinetics of CPTC-YAP1-3 and mouse YAP1 full length recombinant protein were measured using biolayer interferometry. Mouse YAP1 recombinant protein was amine coupled onto AR2G biosensors. CPTC-YAP1-3 mouse antibody at 256 nM, 64 nM, 16 nM, 4 nM, and 1.0 nM, was used as analyte. Buffer only and biosensors immobilized without recombinant protein were used as references for background subtraction. All data was analyzed globally using a bivalent fitting model. Click image to enlarge

CPTC-YAP1-3 Affinity and Kinetics (Bio-Layer Interferometry) 

Result: Positive

Affinity and binding kinetics of CPTC-YAP1-3 and mouse YAP1 full length recombinant protein were measured using biolayer interferometry. Mouse YAP1 recombinant protein was amine coupled onto AR2G biosensors. CPTC-YAP1-3 mouse antibody at 256 nM, 64 nM, 16 nM, 4 nM, and 1.0 nM, was used as analyte. Buffer only and biosensors immobilized without recombinant protein were used as references for background subtraction. All data was analyzed globally using a bivalent fitting model.


Characterization SOP Files

  Affinity Measurement by SPR
Click to enlarge image Affinity and binding kinetics of CPTC-YAP1-3 and mouse YAP1 full length recombinant protein were measured using surface plasmon resonance. Mouse YAP1 full length recombinant protein was amine coupled onto a Series S CM5 biosensor chip. CPTC-YAP1-3 mouse antibody at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, 0.25 nM, and 0.0625 nM was used as analyte. All data were double referenced and analyzed globally using a bivalent fitting model. Click image to enlarge

CPTC-YAP1-3 Affinity and Kinetics (Surface Plasmon Resonance)

Result: Positive

Affinity and binding kinetics of CPTC-YAP1-3 and mouse YAP1 full length recombinant protein were measured using surface plasmon resonance. Mouse YAP1 full length recombinant protein was amine coupled onto a Series S CM5 biosensor chip. CPTC-YAP1-3 mouse antibody at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, 0.25 nM, and 0.0625 nM was used as analyte. All data were double referenced and analyzed globally using a bivalent fitting model.


Characterization SOP Files

  Flow Cytometry
Click to enlarge image Flow cytometric analysis of YAP1 expression in SF-268 and A549 cells using CPTC-YAP1-3 mouse antibody. SF-268 cells were permeabilized and fixed and then stained with CPTC-YAP1-3 antibody (solid green) or concentration-matched mouse IgG1 isotype control antibody (dashed green). A549 cells were permeabilized and fixed and then stained with CPTC-YAP1-3 (solid blue) or concentration-matched mouse IgG1 isotype control antibody (dashed blue) and then fixed. An APC conjugated goat anti-mouse IgG (H+L) was used as a secondary antibody. All data were analyzed using FlowJo. CPTC-YAP1-3 antibody can detect expression of YAP1 in both SF-268 and A549 cells. Click image to enlarge

CPTC-YAP1-3 (Flow Cytometry)

Result: Positive

Flow cytometric analysis of YAP1 expression in SF-268 and A549 cells using CPTC-YAP1-3 mouse antibody. SF-268 cells were permeabilized and fixed and then stained with CPTC-YAP1-3 antibody (solid green) or concentration-matched mouse IgG1 isotype control antibody (dashed green). A549 cells were permeabilized and fixed and then stained with CPTC-YAP1-3 (solid blue) or concentration-matched mouse IgG1 isotype control antibody (dashed blue) and then fixed. An APC conjugated goat anti-mouse IgG (H+L) was used as a secondary antibody. All data were analyzed using FlowJo. CPTC-YAP1-3 antibody can detect expression of YAP1 in both SF-268 and A549 cells.


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array (TMA) core of breast cancer showing cytoplasmic and nuclear staining using Antibody CPTC-YAP1-3. Titer: 1:2000 Click image to enlarge

CPTC-YAP1-3 IHC Tissue

Result: Positive

Tissue Micro-Array (TMA) core of breast cancer showing cytoplasmic and nuclear staining using Antibody CPTC-YAP1-3. Titer: 1:2000


Characterization SOP Files

  IP
Click to enlarge image Immunoprecipitation using CPTC-YAP1-3 as capture antibody against rec YAP1 protein and to probe whole cell lysates of SF-268, EKVX and HeLa. Eluates were tested in Simple Western, using CPTC-YAP1-1 as primary antibody (Panel A). The antibody is able to precipitate recombinant YAP1 and target protein in all tested cell lysates, as also evident in the comparison between input material (blue line) and eluate (green line) profiles in panels B, C, D, E, respectively for rec. YAP1, SF-268, EKVX and HeLa. Click image to enlarge

CPTC-YAP1-3 IP-SW (rec. protein and cell lysates)

Result: Positive

Immunoprecipitation using CPTC-YAP1-3 as capture antibody against rec YAP1 protein and to probe whole cell lysates of SF-268, EKVX and HeLa. Eluates were tested in Simple Western, using CPTC-YAP1-1 as primary antibody (Panel A). The antibody is able to precipitate recombinant YAP1 and target protein in all tested cell lysates, as also evident in the comparison between input material (blue line) and eluate (green line) profiles in panels B, C, D, E, respectively for rec. YAP1, SF-268, EKVX and HeLa.


Characterization SOP Files

  Immunofluorescence

CPTC-YAP1-3 Immunofluorescence

Result: Negative

Immunofluorescence staining using CPTC-YAP1-3 as primary antibody against A549 and SF-268 cells show no localization of YAP1 protein.


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-YAP1-3 as primary mouse antibody against mouse YAP1 full length recombinant protein, coated on the plate and detected using goat anti-mouse antibody and TMB. Click image to enlarge

CPTC-YAP1-3 Indirect ELISA

Result: Positive

Indirect ELISA using CPTC-YAP1-3 as primary mouse antibody against mouse YAP1 full length recombinant protein, coated on the plate and detected using goat anti-mouse antibody and TMB.


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-YAP1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-YAP1-3 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-YAP1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western blot using CPTC-YAP1-3 as primary antibody against recombinant human and mouse YAP1 protein (MYC-tagged) in over-expressed lysates. The antibody is able to detect the target protein in both species. The same MYC-tagged proteins were also tested with an anti-MYC antibody for MW validation. Click image to enlarge

CPTC-YAP1-3 Western Blot (recombinant protein in overexpressed lysate)

Result: Positive

Western blot using CPTC-YAP1-3 as primary antibody against recombinant human and mouse YAP1 protein (MYC-tagged) in over-expressed lysates. The antibody is able to detect the target protein in both species. The same MYC-tagged proteins were also tested with an anti-MYC antibody for MW validation.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Automated WB using CPTC-YAP1-3 as primary antibody against the over-expressed lysates of human YAP1 (MYC tagged) and mouse YAP1 (MYC tagged). The antibody is able to recognize the target protein in both species (top panels). The same MYC tagged recombinant proteins in the over-expressed lysates were tested with an antibody anti-MYC, to confirm size (bottom panels). Click image to enlarge

CPTC-YAP1-3 Automated Western Blot (Over-expressed Lysates)

Result: Positive

Automated WB using CPTC-YAP1-3 as primary antibody against the over-expressed lysates of human YAP1 (MYC tagged) and mouse YAP1 (MYC tagged). The antibody is able to recognize the target protein in both species (top panels). The same MYC tagged recombinant proteins in the over-expressed lysates were tested with an antibody anti-MYC, to confirm size (bottom panels).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Automated WB using CPTC-YAP1-3 as primary antibody against the whole cell lysates of HeLa, MCF7, A549, SF-268 and EKVX. The antibody was able to detect the target protein in SF-268. The same cell lines were also tested with an anti-Cytochrome C antibodies, and they all express the protein. Click image to enlarge

CPTC-YAP1-3 Automated Western Blot (Lysates)

Result: Positive

Automated WB using CPTC-YAP1-3 as primary antibody against the whole cell lysates of HeLa, MCF7, A549, SF-268 and EKVX. The antibody was able to detect the target protein in SF-268. The same cell lines were also tested with an anti-Cytochrome C antibodies, and they all express the protein.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western blot using CPTC-YAP1-3 as primary antibody against whole lysates of HeLa, MCF7, A549, SF-268 and EKVX. The antibody is able to detect the target protein in SF-268 and EKVX. The same cell lines were also tested with an anti-Cytochrome C for loading control. Click image to enlarge

CPTC-YAP1-3 Western Blot (lysates)

Result: Positive

Western blot using CPTC-YAP1-3 as primary antibody against whole lysates of HeLa, MCF7, A549, SF-268 and EKVX. The antibody is able to detect the target protein in SF-268 and EKVX. The same cell lines were also tested with an anti-Cytochrome C for loading control.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Single cell western blot using CPTC-YAP1-3 as a primary antibody against cell lysates. Relative expression of total YAP1 in A549 and SF-268 cells (A). Percentage of cells that express YAP1 (B). Average expression of YAP1 protein per cell (C). All data is normalized to β-tubulin expression. Click image to enlarge

CPTC-YAP1-3 Single Cell Western Blot (Cell Lysate)

Result: Positive

Single cell western blot using CPTC-YAP1-3 as a primary antibody against cell lysates. Relative expression of total YAP1 in A549 and SF-268 cells (A). Percentage of cells that express YAP1 (B). Average expression of YAP1 protein per cell (C). All data is normalized to β-tubulin expression.


Characterization SOP Files

[top]

Antibody: CPTC-YAP1-4
Background

Catalog Number:

CPTC-YAP1-4

Target Antigen:

Yes1 Associated Transcriptional Regulator (mouse)

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

03/12/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry
Click to enlarge image Affinity and binding kinetics of CPTC-YAP1-4 and mouse YAP1 full length recombinant protein were measured using biolayer interferometry. Mouse YAP1 recombinant protein was amine coupled onto the AR2G biosensor. CPTC-YAP1-4 mouse antibody at 256 nM, 64 nM, and 16 nM, was used as analyte. Buffer only and biosensors immobilized without recombinant protein were used as references for background subtraction. All data was analyzed globally using a bivalent fitting model. Click image to enlarge

CPTC-YAP1-4 Affinity and Kinetics (Bio-Layer Interferometry) 

Result: Positive

Affinity and binding kinetics of CPTC-YAP1-4 and mouse YAP1 full length recombinant protein were measured using biolayer interferometry. Mouse YAP1 recombinant protein was amine coupled onto the AR2G biosensor. CPTC-YAP1-4 mouse antibody at 256 nM, 64 nM, and 16 nM, was used as analyte. Buffer only and biosensors immobilized without recombinant protein were used as references for background subtraction. All data was analyzed globally using a bivalent fitting model.


Characterization SOP Files

  Affinity Measurement by SPR
Click to enlarge image Affinity and binding kinetics of CPTC-YAP1-4 and mouse YAP1 full length recombinant protein were measured using surface plasmon resonance. Mouse YAP1 full length recombinant protein was amine coupled onto a Series S CM5 biosensor chip. CPTC-YAP1-4 mouse antibody at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, 0.25 nM, and 0.0625 nM was used as analyte. All data were double referenced and analyzed globally using a bivalent fitting model. Click image to enlarge

CPTC-YAP1-4 Affinity and Kinetics (Surface Plasmon Resonance)

Result: Positive

Affinity and binding kinetics of CPTC-YAP1-4 and mouse YAP1 full length recombinant protein were measured using surface plasmon resonance. Mouse YAP1 full length recombinant protein was amine coupled onto a Series S CM5 biosensor chip. CPTC-YAP1-4 mouse antibody at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, 0.25 nM, and 0.0625 nM was used as analyte. All data were double referenced and analyzed globally using a bivalent fitting model.


Characterization SOP Files

  Flow Cytometry
Click to enlarge image Flow cytometric analysis of YAP1 expression in SF-268 and A549 cells using CPTC-YAP1-4 mouse antibody. SF-268 cells were permeabilized and fixed and then stained with CPTC-YAP1-4 antibody (solid green) or concentration-matched mouse IgG2b isotype control antibody (dashed green). A549 cells were permeabilized and fixed and then stained with CPTC-YAP1-4 (solid blue) or concentration-matched mouse IgG2b isotype control antibody (dashed blue) and then fixed. An APC conjugated goat anti-mouse IgG (H+L) was used as a secondary antibody. All data were analyzed using FlowJo. CPTC-YAP1-4 antibody can detect expression of YAP1 in both SF-268 and A549 cells. Click image to enlarge

CPTC-YAP1-4 (Flow Cytometry)

Result: Positive

Flow cytometric analysis of YAP1 expression in SF-268 and A549 cells using CPTC-YAP1-4 mouse antibody. SF-268 cells were permeabilized and fixed and then stained with CPTC-YAP1-4 antibody (solid green) or concentration-matched mouse IgG2b isotype control antibody (dashed green). A549 cells were permeabilized and fixed and then stained with CPTC-YAP1-4 (solid blue) or concentration-matched mouse IgG2b isotype control antibody (dashed blue) and then fixed. An APC conjugated goat anti-mouse IgG (H+L) was used as a secondary antibody. All data were analyzed using FlowJo. CPTC-YAP1-4 antibody can detect expression of YAP1 in both SF-268 and A549 cells.


Characterization SOP Files

  IHC Tissue

CPTC-YAP1-4 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  IP
Click to enlarge image Immunoprecipitation using CPTC-YAP1-4 as capture antibody against rec YAP1 protein and to probe whole cell lysates of SF-268, EKVX and HeLa. Eluates were tested in Simple Western, using CPTC-YAP1-1 as primary antibody (Panel A). The antibody is able to precipitate recombinant YAP1 and target protein in all tested cell lysates, as also evident in the comparison between input material (blue line) and eluate (green line) profiles in panels B, C, D, E, respectively for rec. YAP1, SF-268, EKVX and HeLa. Click image to enlarge

CPTC-YAP1-4 IP-SW (rec. protein and cell lysates)

Result: Positive

Immunoprecipitation using CPTC-YAP1-4 as capture antibody against rec YAP1 protein and to probe whole cell lysates of SF-268, EKVX and HeLa. Eluates were tested in Simple Western, using CPTC-YAP1-1 as primary antibody (Panel A). The antibody is able to precipitate recombinant YAP1 and target protein in all tested cell lysates, as also evident in the comparison between input material (blue line) and eluate (green line) profiles in panels B, C, D, E, respectively for rec. YAP1, SF-268, EKVX and HeLa.


Characterization SOP Files

  Immunofluorescence

CPTC-YAP1-4 Immunofluorescence

Result: Negative

Immunofluorescence staining using CPTC-YAP1-4 as primary antibody against A549 and SF-268 cells show no localization of YAP1 protein.


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-YAP1-4 as primary mouse antibody against mouse YAP1 full length recombinant protein, coated on the plate and detected using goat anti-mouse antibody and TMB. Click image to enlarge

CPTC-YAP1-4 Indirect ELISA

Result: Positive

Indirect ELISA using CPTC-YAP1-4 as primary mouse antibody against mouse YAP1 full length recombinant protein, coated on the plate and detected using goat anti-mouse antibody and TMB.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-YAP1-4 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Automated WB using CPTC-YAP1-4 as primary antibody against the over-expressed lysates of human YAP1 (MYC tagged) and mouse YAP1 (MYC tagged). The antibody is able to recognize only the target mouse protein (top panels). The same MYC tagged recombinant proteins in the over-expressed lysates were tested with an antibody anti-MYC, to confirm size (bottom panels). Click image to enlarge

CPTC-YAP1-4 Automated Western Blot (Over-expressed Lysates)

Result: Positive

Automated WB using CPTC-YAP1-4 as primary antibody against the over-expressed lysates of human YAP1 (MYC tagged) and mouse YAP1 (MYC tagged). The antibody is able to recognize only the target mouse protein (top panels). The same MYC tagged recombinant proteins in the over-expressed lysates were tested with an antibody anti-MYC, to confirm size (bottom panels).


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western blot using CPTC-YAP1-4 as primary antibody against recombinant human and mouse YAP1 protein (MYC-tagged) in over-expressed lysates. The antibody is able to detect the target protein in both species. The same MYC-tagged proteins were also tested with an anti-MYC antibody for MW validation. Click image to enlarge

CPTC-YAP1-4 Western Blot (recombinant protein in overexpressed lysate)

Result: Positive

Western blot using CPTC-YAP1-4 as primary antibody against recombinant human and mouse YAP1 protein (MYC-tagged) in over-expressed lysates. The antibody is able to detect the target protein in both species. The same MYC-tagged proteins were also tested with an anti-MYC antibody for MW validation.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Automated WB using CPTC-YAP1-3 as primary antibody against the whole cell lysates of HeLa, MCF7, A549, SF-268 and EKVX. The antibody was not able to detect the target protein in the tested lysates. The same cell lines were also tested with an anti-Cytochrome C antibodies, and they all express the protein. Click image to enlarge

CPTC-YAP1-4 Automated Western Blot (Lysates)

Result: Negative

Automated WB using CPTC-YAP1-3 as primary antibody against the whole cell lysates of HeLa, MCF7, A549, SF-268 and EKVX. The antibody was not able to detect the target protein in the tested lysates. The same cell lines were also tested with an anti-Cytochrome C antibodies, and they all express the protein.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western blot using CPTC-YAP1-4 as primary antibody against whole lysates of HeLa, MCF7, A549, SF-268 and EKVX. The antibody is able to detect the target protein in SF-268 and EKVX. The same cell lines were also tested with an anti-Cytochrome C for loading control. Click image to enlarge

CPTC-YAP1-4 Western Blot (lysates)

Result: Positive

Western blot using CPTC-YAP1-4 as primary antibody against whole lysates of HeLa, MCF7, A549, SF-268 and EKVX. The antibody is able to detect the target protein in SF-268 and EKVX. The same cell lines were also tested with an anti-Cytochrome C for loading control.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Single cell western blot using CPTC-YAP1-4 as a primary antibody against cell lysates. Relative expression of total YAP1 in A549 and SF-268 cells (A). Percentage of cells that express YAP1 (B). Average expression of YAP1 protein per cell (C). All data is normalized to β-tubulin expression. Click image to enlarge

CPTC-YAP1-4 Single Cell Western Blot (Cell Lysate)

Result: Positive

Single cell western blot using CPTC-YAP1-4 as a primary antibody against cell lysates. Relative expression of total YAP1 in A549 and SF-268 cells (A). Percentage of cells that express YAP1 (B). Average expression of YAP1 protein per cell (C). All data is normalized to β-tubulin expression.


Characterization SOP Files

[top]

Antigen: Yes1 Associated Transcriptional Regulator (mouse)
Background

NCI Identification Number:

00530

Antigen Name:

Yes1 Associated Transcriptional Regulator (mouse)

CPTC Name:

CPTC-YAP1 (mouse)

Aliases:

Yes1 Associated Transcriptional Regulator; YAP65; Yes-Associated Protein YAP65 Homolog; Transcriptional Coactivator YAP1; Yes Associated Protein 1; Protein Yorkie Homolog; YAP-1; Yes-Associated Protein 1, 65kDa; 65 KDa Yes-Associated Protein; Yes-Associated Protein 2; Yes-Associated Protein 1; Yorkie Homolog; COB1; YAP2; YAP; YKI

Function:

This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2013]YAP1 (Yes1 Associated Transcriptional Regulator) is a Protein Coding gene. Diseases associated with YAP1 include Coloboma, Ocular, With Or Without Hearing Impairment, Cleft Lip/Palate, And/Or Mental Retardation and Coloboma Of Macula. Among its related pathways are CFTR-dependent regulation of ion channels in Airway Epithelium (norm and CF) and RUNX2 regulates bone development. Gene Ontology (GO) annotations related to this gene include chromatin binding and transcription cis-regulatory region binding. An important paralog of this gene is WWTR1.Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis (PubMed:17974916, PubMed:18280240, PubMed:18579750, PubMed:21364637, PubMed:30447097). The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ (PubMed:18158288). Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation. Acts via ARHGAP18, a Rho GTPase activating protein that suppresses F-actin polymerization (PubMed:25778702). Plays a key role in controlling cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration (PubMed:18158288). The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction (PubMed:18579750). Suppresses ciliogenesis via acting as a transcriptional corepressor of the TEAD4 target genes AURKA and PLK1 (PubMed:25849865). In conjunction with WWTR1, involved in the regulation of TGFB1-dependent SMAD2 and SMAD3 nuclear accumulation (By similarity). YAP1_HUMAN,P46937[Isoform 2]: Activates the C-terminal fragment (CTF) of ERBB4 (isoform 3). YAP1_HUMAN,P46937[Isoform 3]: Activates the C-terminal fragment (CTF) of ERBB4 (isoform 3). YAP1_HUMAN,P46937

Chromosomal Localization:

Expression System:

E.coli

Accession Number:

NM_001171147.1

UniProt Accession Number:

P46938

DNA Source:

N/A

Immunogen:

Recombinant Full Length Protein

Vector Name:

pGEX-6P-1

Extinction Coefficient:

Buffers:

PBS

Expressed Sequence:

MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDL
EALFNAVMNP KTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGT
AGALTPQHVRAHSSPASLQLG AVSPGTLTASGVVSGPAAAPAAQHLRQS
SFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQ TTTWQDPRKAMLSQLNV
PAPASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYINHKNKT TSWLDP
RLDPRFAMNQRITQSAPVKQPPPLAPQSPQGGVLGGGSSNQQQQIQLQQL
QMEK ERLRLKQQELFRQAIRNINPSTANAPKCQELALRSQLPTLEQDGG
TPNAVSSPGMSQELR TMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSI
PRTPDDFLNSVDEMDTGDTISQSTLP SQQSRFPDYLEALPGTNVDLGTL
EGDAMNIEGEELMPSLQEALSSEILDVESVLAATKLD KESFLTWL

Native Sequence:

Calculated Isoelectric Point:

Molecular Weight:

52383

Last Updated:

06/10/2022

Links

Characterization Data

SOPs

No SOPs available.

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]