ubiquitin-conjugating enzyme E2, J1


Background

Catalog Number:

CPTC-UBE2J1-1

Target Antigen:

ubiquitin-conjugating enzyme E2, J1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-UBE2J1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-UBE2J1-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-UBE2J1-1 as primary Ab against UBE2J1 (rAg 00013) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-UBE2J1-1 Western blot

Result: Positive

Western Blot using CPTC-UBE2J1-1 as primary Ab against UBE2J1 (rAg 00013) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-UBE2J1-2

Target Antigen:

ubiquitin-conjugating enzyme E2, J1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-UBE2J1-2. Titer: 1:30000 Click image to enlarge

CPTC-UBE2J1-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-UBE2J1-2. Titer: 1:30000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-UBE2J1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-UBE2J1-2 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-UBE2J1-2 as primary Ab against UBE2J1 (rAg 00013) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-UBE2J1-2 Western blot

Result: Positive

Western Blot using CPTC-UBE2J1-2 as primary Ab against UBE2J1 (rAg 00013) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-UBE2J1-3

Target Antigen:

ubiquitin-conjugating enzyme E2, J1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-UBE2J1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-UBE2J1-3 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-UBE2J1-3 as primary Ab against UBE2J1 (rAg 00013) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-UBE2J1-3 Western blot

Result: Positive

Western Blot using CPTC-UBE2J1-3 as primary Ab against UBE2J1 (rAg 00013) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

00013

Antigen Name:

ubiquitin-conjugating enzyme E2, J1

CPTC Name:

CPTC-UBE2J1

Keywords:

NCUBE1; HSPC153; UBC6; Non-canonical ubiquitin-conjugating enzyme 1; Yeast ubiquitin-conjugating enzyme UBC6 homolog E; NCUBE-1; CGI-76; HSPC205; HSU93243; HSUBC6e; Ubc6p; ubiquitin-conjugating enzyme E2, J1, U; EC 6.3.2.19; HsUBC6e

Function:

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system.

Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum.

Chromosomal Localization:

6q15

Expression System:

E.coli

NCBI Accession Number:

NM_016021

Swiss Prot Accession Number:

Q9Y385

DNA Source:

Imagenes

Immunogen:

Recombinant Full Length Protein

Vector Name:

pNIC28-Bsa4

Extinction Coefficient:

Buffers:

NaP

Expressed Sequence:

MHHHHHHSSGVDLGTENLYFQSMSPAVKRLMKEAAELKDPTDHYHAQPLE
DNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFE
VGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPE
ERRALAKKSQDFCCEGCGSAMKDVLL

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

19659

Last Updated:

11/06/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of UBE2J1 (rAg 00013) with molecular weight standards in lane 1.
Click image to enlarge

CPTC-UBE2J1 PAGE

PAGE of UBE2J1 (rAg 00013) with molecular weight standards in lane 1.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com