DNA Topoisomerase I


Background

Catalog Number:

CPTC-TOP1-1

RRID:

AB_10805153

Target Antigen:

DNA Topoisomerase I

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (99.4 KB)

CPTC-TOP1-1 Evaluation by Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPCT-TOP1-1 ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-TOP1-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TOP1-1 as primary Ab against TOP1 (rAg 00004) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TOP1-1 Western blot

Result: Positive

Western Blot using CPTC-TOP1-1 as primary Ab against TOP1 (rAg 00004) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-TOP1-2

RRID:

AB_10805281

Target Antigen:

DNA Topoisomerase I

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (99.6 KB)

CPTC-TOP1-2 Evaluation by Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPCT-TOP1-2 ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-TOP1-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TOP1-2 as primary Ab against TOP1 (rAg 00004) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TOP1-2 Western blot

Result: Positive

Western Blot using CPTC-TOP1-2 as primary Ab against TOP1 (rAg 00004) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-TOP1-3

Target Antigen:

DNA Topoisomerase I

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

10/28/2020

Antigen Recognition(s):

SOP:

Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (101.2 KB)

CPTC-TOP1-3 Evaluation by Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPCT-TOP1-3 ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TOP1-3 as primary Ab against TOP1 (rAg 00004) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TOP1-3 Western blot

Result: Positive

Western Blot using CPTC-TOP1-3 as primary Ab against TOP1 (rAg 00004) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

00004

Antigen Name:

DNA Topoisomerase I

CPTC Name:

CPTC-TOP1

Keywords:

topoisomerase (DNA) I; DNA Topoisomerase I; DNA Topoisomerase 1; Scl-70 Antigen; Type I DNA Topoisomerase; EC 5.99.1.2; EC 5.6.2.1; TOPI; TOP1

Function:

This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22. TOP1 (DNA Topoisomerase I) is a Protein Coding gene. Diseases associated with TOP1 include Systemic Scleroderma and Spinocerebellar Ataxia, Autosomal Recessive, With Axonal Neuropathy 1. Among its related pathways are Telomere C-strand (Lagging Strand) Synthesis and Apoptosis and survival Caspase cascade. Gene Ontology (GO) annotations related to this gene include core promoter sequence-specific DNA binding. An important paralog of this gene is TOP1MT.Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(3'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 5'-OH DNA strand. The free DNA strand then rotates around the intact phosphodiester bond on the opposing strand, thus removing DNA supercoils. Finally, in the religation step, the DNA 5'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone (By similarity). Regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells. Involved in the circadian transcription of the core circadian clock component ARNTL/BMAL1 by altering the chromatin structure around the ROR response elements (ROREs) on the ARNTL/BMAL1 promoter.Topoisomerases are ubiquitously expressed enzymes that overcome topological problems in genomic DNA, which can result from DNA replication, transcription and repair. Common problems such as knots and tangles are often resolved by topoisomerases.

Chromosomal Localization:

20q12

Expression System:

E. coli

NCBI Accession Number:

NP_003277.1

UniProt Accession Number:

P11387

DNA Source:

PEL:5165-X01-008

Immunogen:

Recombinant Full Length Protein

Vector Name:

pFastBac1

Extinction Coefficient:

Buffers:

Expressed Sequence:

MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHS
NSEHKDSEKKHKEKEKTKHKDGSSEK HKDKHKDRDKEKRKEEKVRASGD
AKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDVDYKP
KKI KTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKE
EEQKWKWWEEERYPEGIKWKFLEHKGPVFA PPYEPLPENVKFYYDGKVM
KLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNL
SKCDFTQ MSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNH
KERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPE DIIINCSKDAKVPSP
PPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYE
TARRLKKCVDK IRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKE
EGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGK DSIRYYNKVPV
EKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYN
ASITLQQQLKELTAP DENIPAKILSYNRANRAVAILCNHQRAPPKTFEK
SMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVV ESKKKAV
QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIE
KIYNKTQREKFAWAIDMAD EDYEF

Native Sequence:

MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHS
NSEHKDSEKKHKEKEKTKHKDGSSEK HKDKHKDRDKEKRKEEKVRASGD
AKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDVDYKP
KKI KTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKE
EEQKWKWWEEERYPEGIKWKFLEHKGPVFA PPYEPLPENVKFYYDGKVM
KLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNL
SKCDFTQ MSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNH
KERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPE DIIINCSKDAKVPSP
PPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYE
TARRLKKCVDK IRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKE
EGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGK DSIRYYNKVPV
EKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYN
ASITLQQQLKELTAP DENIPAKILSYNRANRAVAILCNHQRAPPKTFEK
SMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVV ESKKKAV
QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIE
KIYNKTQREKFAWAIDMAD EDYEF

Calculated Isoelectric Point:

0

Molecular Weight:

90726

Last Updated:

09/30/2020

Links

Characterization Data

Gel

Click to enlarge image PAGE of recombinant Topoisomerase (CPTC-TOP1) (with molecular weight standards in lane 1)
Click image to enlarge

CPTC-TOP1 PAGE

PAGE of recombinant Topoisomerase (CPTC-TOP1) (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com