Topoisomerase I


Background

Catalog Number:

CPTC-TOP1-1

Target Antigen:

Topoisomerase I

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

05/22/2014

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPCT-TOP1-1 ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  Western Blot
Click to enlarge image Western Blot using CPTC-TOP1-1 as primary Ab against TOP1 (rAg 00004) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TOP1-1 Western blot

Western Blot using CPTC-TOP1-1 as primary Ab against TOP1 (rAg 00004) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (99.4 KB)

CPTC-TOP1-1 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

  NCI 60 Protein Array

CPTC-TOP1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-TOP1-2

Target Antigen:

Topoisomerase I

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

05/22/2014

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPCT-TOP1-2 ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  Western Blot
Click to enlarge image Western Blot using CPTC-TOP1-2 as primary Ab against TOP1 (rAg 00004) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TOP1-2 Western blot

Western Blot using CPTC-TOP1-2 as primary Ab against TOP1 (rAg 00004) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (99.6 KB)

CPTC-TOP1-2 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

  NCI 60 Protein Array

CPTC-TOP1-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-TOP1-3

Target Antigen:

Topoisomerase I

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

SOP:

Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPCT-TOP1-3 ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  Western Blot
Click to enlarge image Western Blot using CPTC-TOP1-3 as primary Ab against TOP1 (rAg 00004) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TOP1-3 Western blot

Western Blot using CPTC-TOP1-3 as primary Ab against TOP1 (rAg 00004) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (101.2 KB)

CPTC-TOP1-3 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

NCI Identification Number:

00004

Antigen Name:

Topoisomerase I

CPTC Name:

CPTC-TOP1

Keywords:

topoisomerase (DNA) I; EC 5.99.1.2; TOP1; DNA topoisomerase 1; type I DNA topoisomerase

Function:

Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(3'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 5'-OH DNA strand. The free DNA strand than undergoes passage around the unbroken strand thus removing DNA supercoils.

Finally, in the religation step, the DNA 5'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone (By similarity). Regulates the alternative splicing of tissue factor (F3)pre-mRNA in endothelial cells.

Topoisomerases are ubiquitously expressed enzymes that overcome topological problems in genomic DNA, which can result from DNA replication, transcription and repair. Common problems such as overwinding (positive supercoiling), knots and tangles are resolved by topoisomerases by catalysing the breaking of one or two
strands of DNA. Topoisomerase type I enzymes cut just one strand of the DNA double helix, and hence relax supercoiling of the DNA. Four genes encode Type I topoisomerases, which include nuclear topoisomerase I(TOP1) and mitochondrial topoisomerase I (TOP1MT). Type I enzymes can also be sub-divided into Types A and B based on their different catalytic mechanism for generating single DNA strand breaks. TOP1 and TOP1MT are both type 1B since they form 3'-phosphotyrosyl bonds. Camptothecin is a natural product inhibitor of TOP1 that has led to the discovery of derivatives that are clinically used anti-cancer drugs. Such inhibitors trap the enzyme in a cleavage complex with DNA. Type II topoisomerases (IIA and IIB) are particular important for the disentanglement of DNA, which is overcome by generating double stranded DNA breaks. Dysregulation of type II enzymes can therefore have a potentially significant genotoxic effect. There is a broad range of topoisomerase II inhibitors that are used clinically as anticancer agents.

Chromosomal Localization:

20q12 - q13.1

Expression System:

E. coli

NCBI Accession Number:

NP_003277

Swiss Prot Accession Number:

P11387

DNA Source:

PEL:5165-X01-008

Immunogen:

Recombinant Full Length Protein

Vector Name:

pFastBac1

Extinction Coefficient:

Buffers:

Expressed Sequence:

MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHS
NSEHKDSEKKHKEKEKTKHKDGSSEK HKDKHKDRDKEKRKEEKVRASGD
AKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDVDYKP
KKI KTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKE
EEQKWKWWEEERYPEGIKWKFLEHKGPVFA PPYEPLPENVKFYYDGKVM
KLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNL
SKCDFTQ MSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNH
KERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPE DIIINCSKDAKVPSP
PPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYE
TARRLKKCVDK IRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKE
EGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGK DSIRYYNKVPV
EKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYN
ASITLQQQLKELTAP DENIPAKILSYNRANRAVAILCNHQRAPPKTFEK
SMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVV ESKKKAV
QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIE
KIYNKTQREKFAWAIDMAD EDYEF

Native Sequence:

MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHS
NSEHKDSEKKHKEKEKTKHKDGSSEK HKDKHKDRDKEKRKEEKVRASGD
AKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDVDYKP
KKI KTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKE
EEQKWKWWEEERYPEGIKWKFLEHKGPVFA PPYEPLPENVKFYYDGKVM
KLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNL
SKCDFTQ MSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNH
KERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPE DIIINCSKDAKVPSP
PPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYE
TARRLKKCVDK IRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKE
EGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGK DSIRYYNKVPV
EKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYN
ASITLQQQLKELTAP DENIPAKILSYNRANRAVAILCNHQRAPPKTFEK
SMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVV ESKKKAV
QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIE
KIYNKTQREKFAWAIDMAD EDYEF

Calculated Isoelectric Point:

0

Molecular Weight:

90726

Last Updated:

08/31/2012

Links

Characterization Data

Gel

Click to enlarge image PAGE of recombinant Topoisomerase (CPTC-TOP1) (with molecular weight standards in lane 1)
Click image to enlarge

CPTC-TOP1 PAGE

PAGE of recombinant Topoisomerase (CPTC-TOP1) (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com