Tumor necrosis factor receptor superfamily member 9


Background

Catalog Number:

CPTC-TNFRSF9-1

Target Antigen:

Tumor necrosis factor receptor superfamily member 9

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/06/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-TNFRSF9-1 as primary Ab against TNFRSF9 (rAg 10673) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TNFRSF9-1 Western blot

Western Blot using CPTC-TNFRSF9-1 as primary Ab against TNFRSF9 (rAg 10673) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TNFRSF9-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-TNFRSF9-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-TNFRSF9-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-TNFRSF9-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  Affinity Measurement by SPR
Download TNFRSF9 pairing.docx (742.1 KB)

Pairing Studies

This file summarizes the results of pairing studies using SPR.

  Affinity Measurement by SPR
Download TNFRSF9 pairing.docx (742.1 KB)

Pairing Studies

This file summarizes the results of pairing studies using SPR.

  Affinity Measurement by SPR
Download TNFRSF9 pairing.docx (742.1 KB)

Pairing Studies

This file summarizes the results of pairing studies using SPR.

Background

Catalog Number:

CPTC-TNFRSF9-2

Target Antigen:

Tumor necrosis factor receptor superfamily member 9

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/06/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-TNFRSF9-2 as primary Ab against TNFRSF9 (rAg 10673) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TNFRSF9-2 Western blot

Western Blot using CPTC-TNFRSF9-2 as primary Ab against TNFRSF9 (rAg 10673) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TNFRSF9-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-TNFRSF9-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-TNFRSF9-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-TNFRSF9-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  Affinity Measurement by SPR
Download TNFRSF9 pairing.docx (742.1 KB)

Pairing Studies

This file summarizes the results of pairing studies using SPR.

Background

Catalog Number:

CPTC-TNFRSF9-3

Target Antigen:

Tumor necrosis factor receptor superfamily member 9

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/06/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-TNFRSF9-3 as primary Ab against TNFRSF9 (rAg 10673) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TNFRSF9-3 Western blot

Western Blot using CPTC-TNFRSF9-3 as primary Ab against TNFRSF9 (rAg 10673) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TNFRSF9-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-TNFRSF9-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-TNFRSF9-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-TNFRSF9-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  Affinity Measurement by SPR
Download TNFRSF9 pairing.docx (742.1 KB)

Pairing Studies

This file summarizes the results of pairing studies using SPR.

Background

NCI Identification Number:

10673

Antigen Name:

Tumor necrosis factor receptor superfamily member 9

CPTC Name:

CPTC-TNFRSF9

Keywords:

tumor necrosis factor receptor superfamily, member 9; CD137; ILA; 4-1BB; T-cell antigen ILA; CD137 antigen; T-cell antigen 4-1BB homolog; CDw137; 4-1BB ligand receptor; interleukin-activated receptor, homolog of mouse Ly63; induced by lymphocyte activation (ILA); T cell antigen ILA; homolog of mouse 4-1BB; MGC2172; FLJ43501; tumor necrosis factor receptor superfamily member 9; receptor protein 4-BB

Function:

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal
expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB.

Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation.

Chromosomal Localization:

1p36

Expression System:

E. Coli

NCBI Accession Number:

NM_001561.4

Swiss Prot Accession Number:

Q07011

DNA Source:

DNASU - HsCD00000130

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

6125

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGV
FRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCC
FGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASS
VTPPAPAREPGHSPQII

Native Sequence:

MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPP
NSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCS
MCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNG
TKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALL
FLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEE
GGCEL

Calculated Isoelectric Point:

7.75

Molecular Weight:

17665

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click image to enlarge

CPTC-TNFRSF9 PAGE

PAGE of TNFRSF9 (rAg 10673) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com