TNF Receptor Superfamily Member 9


Background

Catalog Number:

CPTC-TNFRSF9-1

RRID:

AB_2617355

Target Antigen:

TNF Receptor Superfamily Member 9

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

08/25/2021

Antigen Recognition(s):

Recombinant Full-length

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This file summarizes the results of pairing studies using SPR. (742.1 KB)

Pairing Studies

Result: Positive

This file summarizes the results of pairing studies using SPR.


  IHC HPA

CPTC-TNFRSF9-1 Evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-TNFRSF9-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-TNFRSF9-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TNFRSF9-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-TNFRSF9-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TNFRSF9-1 as primary Ab against TNFRSF9 (rAg 10673) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TNFRSF9-1 Western blot

Result: Positive

Western Blot using CPTC-TNFRSF9-1 as primary Ab against TNFRSF9 (rAg 10673) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-TNFRSF9-2

RRID:

AB_2617356

Target Antigen:

TNF Receptor Superfamily Member 9

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

08/25/2021

Antigen Recognition(s):

Recombinant Full-length

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This file summarizes the results of pairing studies using SPR. (742.1 KB)

Pairing Studies

Result: Positive

This file summarizes the results of pairing studies using SPR.


  IHC HPA

CPTC-TNFRSF9-2 Evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-TNFRSF9-2 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-TNFRSF9-2 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TNFRSF9-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-TNFRSF9-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TNFRSF9-2 as primary Ab against TNFRSF9 (rAg 10673) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TNFRSF9-2 Western blot

Result: Positive

Western Blot using CPTC-TNFRSF9-2 as primary Ab against TNFRSF9 (rAg 10673) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-TNFRSF9-3

RRID:

AB_2617357

Target Antigen:

TNF Receptor Superfamily Member 9

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

08/25/2021

Antigen Recognition(s):

Recombinant Full-length

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This file summarizes the results of pairing studies using SPR. (742.1 KB)

Pairing Studies

Result: Positive

This file summarizes the results of pairing studies using SPR.


  IHC HPA

CPTC-TNFRSF9-3 Evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-TNFRSF9-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-TNFRSF9-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TNFRSF9-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-TNFRSF9-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TNFRSF9-3 as primary Ab against TNFRSF9 (rAg 10673) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TNFRSF9-3 Western blot

Result: Positive

Western Blot using CPTC-TNFRSF9-3 as primary Ab against TNFRSF9 (rAg 10673) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10673

Antigen Name:

TNF Receptor Superfamily Member 9

CPTC Name:

CPTC-TNFRSF9

Keywords:

tumor necrosis factor receptor superfamily, member 9; TNF Receptor Superfamily Member 9; CD137; Tumor Necrosis Factor Receptor Superfamily Member 9; T-Cell Antigen 4-1BB Homolog; 4-1BB Ligand Receptor; CD137 Antigen; CDw137; 4-1BB; ILA; Interleukin-Activated Receptor, Homolog Of Mouse Ly63; Induced By Lymphocyte Activation (ILA); Homolog Of Mouse 4-1BB; Receptor Protein 4-1BB; T Cell Antigen ILA; T-Cell Antigen ILA; TNFRSF9

Function:

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB.TNFRSF9 (TNF Receptor Superfamily Member 9) is a Protein Coding gene. Diseases associated with TNFRSF9 include Immunodeficiency 16 and Nodular Goiter. Among its related pathways are Innate Immune System and PEDF Induced Signaling. Gene Ontology (GO) annotations related to this gene include cytokine binding. An important paralog of this gene is TNFRSF21.Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.

Chromosomal Localization:

1p36.23

Expression System:

E. Coli

NCBI Accession Number:

NP_001552.2

UniProt Accession Number:

Q07011

DNA Source:

DNASU - HsCD00000130

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

6125

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGV
FRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCC
FGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASS
VTPPAPAREPGHSPQII

Native Sequence:

MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPP
NSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCS
MCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNG
TKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALL
FLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEE
GGCEL

Calculated Isoelectric Point:

7.75

Molecular Weight:

17665

Last Updated:

03/24/2021

Links

Characterization Data

Gel

Click to enlarge image PAGE of TNFRSF9 (rAg 10673) with molecular weight standards in lane 1
Click image to enlarge

CPTC-TNFRSF9 PAGE

PAGE of TNFRSF9 (rAg 10673) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com