Supervillin


Background

Catalog Number:

CPTC-SVIL-1

Target Antigen:

Supervillin

Isotype:

IgG

Species:

Rabbit Recombinant Cloned Antibody

Last Updated:

02/09/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Publications
Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry
Click to enlarge image Affinity and binding kinetics of CPTC-SVIL-1 and h340 recombinant protein using biolayer interferometry. CPTC-SVIL-1 antibody was covalently immobilized on amine-reactive second-generation sensors. H340 recombinant protein, 4 nM, 8 nM, and 16 nM, was used as analyte. R2 = 0.983. Rate constants were calculated by applying a 2:1 (heterogeneous) interaction model (global fit, full). KD (nM) – 4.21, Ka (1/Ms) – 1.18 x 105, Kd (1/s) – 4.96 x 10-4. Click image to enlarge

CPTC-SVIL-1 Affinity and Kinetics (Recombinant Protein)

Result: High Binding

Affinity and binding kinetics of CPTC-SVIL-1 and h340 recombinant protein using biolayer interferometry. CPTC-SVIL-1 antibody was covalently immobilized on amine-reactive second-generation sensors. H340 recombinant protein, 4 nM, 8 nM, and 16 nM, was used as analyte. R2 = 0.983. Rate constants were calculated by applying a 2:1 (heterogeneous) interaction model (global fit, full). KD (nM) – 4.21, Ka (1/Ms) – 1.18 x 105, Kd (1/s) – 4.96 x 10-4.


  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (493.9 KB)

CPTC-SVIL-1 evaluation by the Human Protein Atlas

Result: Positive

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org).
The subcellular location is supported by literature.  Immunofluorescent staining of human cell line THP-1 shows localization to plasma membrane. Human assay: THP-1 fixed with PFA, dilution: 1:100
Human assay: U2OS fixed with PFA, dilution: 1:100 Click image to enlarge

CPTC-SVIL-1 evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org).
The subcellular location is supported by literature. Immunofluorescent staining of human cell line THP-1 shows localization to plasma membrane. Human assay: THP-1 fixed with PFA, dilution: 1:100
Human assay: U2OS fixed with PFA, dilution: 1:100


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SVIL-1 as primary Ab against Supervillin H340 (rAg 00259) (lane 2). Also included are molecular wt. standards (lane 1) Click image to enlarge

CPTC-SVIL-1 Western blot

Result: Positive

Western Blot using CPTC-SVIL-1 as primary Ab against Supervillin H340 (rAg 00259) (lane 2). Also included are molecular wt. standards (lane 1)


Characterization SOP Files

Background

Catalog Number:

CPTC-SVIL-2

Target Antigen:

Supervillin

Isotype:

IgG

Species:

Rabbit Recombinant Cloned Antibody

Last Updated:

02/09/2024

Antigen Recognition(s):

Recombinant Full-length

Purchase
Publications
Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry
Click to enlarge image Affinity and binding kinetics of CPTC-SVIL-2 and h340 recombinant protein using biolayer interferometry. CPTC-SVIL-2 antibody was covalently immobilized on amine-reactive second-generation sensors. H340 recombinant protein, 7.8 nM, 15.6 nM, was used as analyte. R2 = 0.965. Rate constants were calculated by applying a 2:1 (heterogeneous) interaction model (global fit, full). KD (nM) – 0.73, Ka (1/Ms) – 4.07 x 105, Kd (1/s) – 2.96 x 10-4. Click image to enlarge

CPTC-SVIL-2 Affinity and Kinetics (Recombinant Protein)

Result: High Binding

Affinity and binding kinetics of CPTC-SVIL-2 and h340 recombinant protein using biolayer interferometry. CPTC-SVIL-2 antibody was covalently immobilized on amine-reactive second-generation sensors. H340 recombinant protein, 7.8 nM, 15.6 nM, was used as analyte. R2 = 0.965. Rate constants were calculated by applying a 2:1 (heterogeneous) interaction model (global fit, full). KD (nM) – 0.73, Ka (1/Ms) – 4.07 x 105, Kd (1/s) – 2.96 x 10-4.


  IHC HPA
Download Results provided by the Human Protein Atlas (www.proteinatlas.org). (468.6 KB)

CPTC-SVIL-2 evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org).


  Immunofluorescence - HPA
Download Results provided by the Human Protein Atlas (www.proteinatlas.org). (468.6 KB)

CPTC-SVIL-2 evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SVIL-2 as primary Ab against Supervillin H340 (rAg 00259) (lane 2). Also included are molecular wt. standards (lane 1) Click image to enlarge

CPTC-SVIL-2 Western blot

Result: Positive

Western Blot using CPTC-SVIL-2 as primary Ab against Supervillin H340 (rAg 00259) (lane 2). Also included are molecular wt. standards (lane 1)


Characterization SOP Files

Background

Catalog Number:

CPTC-SVIL-3

RRID:

AB_2753321

Target Antigen:

Supervillin

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

09/15/2021

Antigen Recognition(s):

Recombinant Full-length

Purchase
Publications
Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry
Click to enlarge image Affinity and binding kinetics of CPTC-SVIL-3 and h340 recombinant protein using biolayer interferometry. CPTC-SVIL-3 antibody was covalently immobilized on amine-reactive second-generation sensors. H340 recombinant protein, 1.95 nM, 3.9 nM, and 7.8 nM, was used as analyte. R2 = 0.997. Rate constants were calculated by applying a 2:1 (heterogeneous) interaction model (global fit, full). KD (nM) – 0.53, Ka (1/Ms) – 7.28 x 105, Kd (1/s) – 3.87 x 10-4. Click image to enlarge

CPTC-SVIL-3 Affinity and Kinetics (Recombinant Protein)

Result: High Binding

Affinity and binding kinetics of CPTC-SVIL-3 and h340 recombinant protein using biolayer interferometry. CPTC-SVIL-3 antibody was covalently immobilized on amine-reactive second-generation sensors. H340 recombinant protein, 1.95 nM, 3.9 nM, and 7.8 nM, was used as analyte. R2 = 0.997. Rate constants were calculated by applying a 2:1 (heterogeneous) interaction model (global fit, full). KD (nM) – 0.53, Ka (1/Ms) – 7.28 x 105, Kd (1/s) – 3.87 x 10-4.


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (437.4 KB)

CPTC-SVIL-3 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SVIL-3 as primary Ab against Supervillin H340 (rAg 00259) (lane 2). Also included are molecular wt. standards (lane 1) Click image to enlarge

CPTC-SVIL-3 Western blot

Result: Positive

Western Blot using CPTC-SVIL-3 as primary Ab against Supervillin H340 (rAg 00259) (lane 2). Also included are molecular wt. standards (lane 1)


Characterization SOP Files

Background

Catalog Number:

CPTC-SVIL-4

RRID:

AB_2753322

Target Antigen:

Supervillin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/15/2021

Antigen Recognition(s):

Recombinant Full-length

Purchase
Publications
Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry
Click to enlarge image Affinity and binding kinetics of CPTC-SVIL-4 and h340 recombinant protein using biolayer interferometry. CPTC-SVIL-4 antibody was covalently immobilized on amine-reactive second-generation sensors. H340 recombinant protein, 4 nM, 8 nM, and 16 nM, was used as analyte. R2 = 0.993. Rate constants were calculated by applying a 2:1 (heterogeneous) interaction model (global fit, full). KD (nM) – 3.22, Ka (1/Ms) – 1.50 x 105, Kd (1/s) – 4.85 x 10-4. Click image to enlarge

CPTC-SVIL-4 Affinity and Kinetics (Recombinant Protein)

Result: High Binding

Affinity and binding kinetics of CPTC-SVIL-4 and h340 recombinant protein using biolayer interferometry. CPTC-SVIL-4 antibody was covalently immobilized on amine-reactive second-generation sensors. H340 recombinant protein, 4 nM, 8 nM, and 16 nM, was used as analyte. R2 = 0.993. Rate constants were calculated by applying a 2:1 (heterogeneous) interaction model (global fit, full). KD (nM) – 3.22, Ka (1/Ms) – 1.50 x 105, Kd (1/s) – 4.85 x 10-4.


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (277.3 KB)

CPTC-SVIL-4 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SVIL-4 as primary Ab against Supervillin H340 (rAg 00259) (lane 2). Also included are molecular wt. standards (lane 1) Click image to enlarge

CPTC-SVIL-4 Western blot

Result: Positive

Western Blot using CPTC-SVIL-4 as primary Ab against Supervillin H340 (rAg 00259) (lane 2). Also included are molecular wt. standards (lane 1)


Characterization SOP Files

Background

NCI Identification Number:

00259

Antigen Name:

Supervillin

CPTC Name:

CPTC-SVIL

Aliases:

Supervillin; Archvillin; P205/P250; Membrane-Associated F-Actin Binding Protein P205

Function:

This gene encodes a bipartite protein with distinct amino- and carboxy-terminal domains. The amino-terminus contains nuclear localization signals and the carboxy-terminus contains numerous consecutive sequences with extensive similarity to proteins in the gelsolin family of actin-binding proteins, which cap, nucleate, and/or sever actin filaments. The gene product is tightly associated with both actin filaments and plasma membranes, suggesting a role as a high-affinity link between the actin cytoskeleton and the membrane. The encoded protein appears to aid in both myosin II assembly during cell spreading and disassembly of focal adhesions. Several transcript variants encoding different isoforms of supervillin have been described.

SVIL (Supervillin) is a Protein Coding gene. Among its related pathways are Coregulation of Androgen receptor activity. Gene Ontology (GO) annotations related to this gene include actin binding and actin filament binding. An important paralog of this gene is FLII.

Isoform 1: Forms a high-affinity link between the actin cytoskeleton and the membrane. Is among the first costameric proteins to assemble during myogenesis and it contributes to myogenic membrane structure and differentiation (PubMed:12711699). Appears to be involved in myosin II assembly. May modulate myosin II regulation through MLCK during cell spreading, an initial step in cell migration. May play a role in invadopodial function (PubMed:19109420).

Isoform 2: May be involved in modulation of focal adhesions. Supervillin-mediated down-regulation of focal adhesions involves binding to TRIP6. Plays a role in cytokinesis through KIF14 interaction (By similarity).

Chromosomal Localization:

10p11.23

Expression System:

E.coli

Accession Number:

NM_001323599.1

UniProt Accession Number:

O95425

DNA Source:

N/A

Immunogen:

Recombinant Domain

Vector Name:

xx

Extinction Coefficient:

Buffers:

Expressed Sequence:

mkrkeriarrlegiendtqpillqsctglvthrlleedtprymrasdpas
phigrsneeeetsdsslekqtrskyctetsgvhgdspygsgtmdthsles
kaeriarykaerrrqlaekygltldpeadseylsrytksrkepdavekrg
gksdkqeessrdasslypgtetmglrtcageskdyalhvgdgssdpevll
nienqrrgqelsatrqahdlspaaessstfsfsgrdssftevprspkhah
ssslqqaasrspsfgdpqlspearprctshsetptvddeekvderaklsv

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

37400

Last Updated:

05/17/2018

Links

Characterization Data

SOPs

No SOPs available.

Don't have Adobe Reader™?

Get it for free at Adobe.com