Catalog Number:
CPTC-SVIL-1
Target Antigen:
Supervillin
Isotype:
IgG
Species:
Rabbit Recombinant Cloned Antibody
Last Updated:
01/02/2026
Antigen Recognition(s):
Recombinant Full-length, Endogenous
Result: High Binding
Affinity and binding kinetics of CPTC-SVIL-1 and h340 recombinant protein using biolayer interferometry. CPTC-SVIL-1 antibody was covalently immobilized on amine-reactive second-generation sensors. H340 recombinant protein, 4 nM, 8 nM, and 16 nM, was used as analyte. R2 = 0.983. Rate constants were calculated by applying a 2:1 (heterogeneous) interaction model (global fit, full). KD (nM) – 4.21, Ka (1/Ms) – 1.18 x 105, Kd (1/s) – 4.96 x 10-4.
Result: Positive
Flow cytometric analysis of Supervillin (SVIL) expression using CPTC-SVIL-1 rabbit antibody. Human SNB19 cells were fixed, permeabilized, and then stained with CPTC-SVIL-1 (solid green) or concentration-matched rabbit IgG isotype control (dashed green) antibodies. Human MOLT4 cells were fixed, permeabilized, and then stained with CPTC-SVIL-1 (solid blue) or concentration-matched rabbit IgG isotype control (dashed blue) antibodies. A BV421 conjugated goat anti-rabbit IgG was used as a secondary antibody. All data were analyzed using FlowJo.
Result: Positive
This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).
Result: Positive
Immunofluorescence staining using CPTC-SVIL-1 as primary antibody (pink-violet) against MOLT-4 and SNB19 cells. Both cell lines show SVIL protein subcellular localization in the cell membrane, cytoskeleton and cytoplasm.
Result: Positive
Results provided by the Human Protein Atlas (www.proteinatlas.org).
The subcellular location is supported by literature. Immunofluorescent staining of human cell line THP-1 shows localization to plasma membrane. Human assay: THP-1 fixed with PFA, dilution: 1:100
Human assay: U2OS fixed with PFA, dilution: 1:100
Result: Positive
Western Blot using CPTC-SVIL-1 as primary Ab against Supervillin H340 (rAg 00259) (lane 2). Also included are molecular wt. standards (lane 1)
Result: Positive
Western blot using CPTC-SVIL-1 as primary antibody against the whole lysates of HeLa, UO-31, TK-10, SNB-19, MOLT-4, and RPMI-8226. The antibody detected the target protein (~247.7 KDa) in HeLa, TK-10, and SNB-19 cell lysates.
Catalog Number:
CPTC-SVIL-2
Target Antigen:
Supervillin
Isotype:
IgG
Species:
Rabbit Recombinant Cloned Antibody
Last Updated:
01/02/2026
Antigen Recognition(s):
Recombinant Full-length, Endogenous
Result: High Binding
Affinity and binding kinetics of CPTC-SVIL-2 and h340 recombinant protein using biolayer interferometry. CPTC-SVIL-2 antibody was covalently immobilized on amine-reactive second-generation sensors. H340 recombinant protein, 7.8 nM, 15.6 nM, was used as analyte. R2 = 0.965. Rate constants were calculated by applying a 2:1 (heterogeneous) interaction model (global fit, full). KD (nM) – 0.73, Ka (1/Ms) – 4.07 x 105, Kd (1/s) – 2.96 x 10-4.
Result: Positive
Flow cytometric analysis of Supervillin (SVIL) expression using CPTC-SVIL-2 rabbit antibody. Human SNB19 cells were fixed, permeabilized, and then stained with CPTC-SVIL-2 (solid green) or concentration-matched rabbit IgG isotype control (dashed green) antibodies. Human MOLT4 cells were fixed, permeabilized, and then stained with CPTC-SVIL-2 (solid blue) or concentration-matched rabbit IgG isotype control (dashed blue) antibodies. A BV421 conjugated goat anti-rabbit IgG was used as a secondary antibody. All data were analyzed using FlowJo.
Result: Negative
Results provided by the Human Protein Atlas (www.proteinatlas.org).
Result: Positive
Immunofluorescence staining using CPTC-SVIL-2 as primary antibody (pink-violet) against MOLT-4 and SNB19 cells. Both cell lines show SVIL protein subcellular localization in the cell membrane, cytoskeleton and cytoplasm.
Result: Negative
Results provided by the Human Protein Atlas (www.proteinatlas.org).
Result: Positive
Western Blot using CPTC-SVIL-2 as primary Ab against Supervillin H340 (rAg 00259) (lane 2). Also included are molecular wt. standards (lane 1)
Result: Presumed Positive (with additional bands)
Western blot using CPTC-SVIL-2 as primary antibody against the whole lysates of HeLa, UO-31, TK-10, SNB-19, MOLT-4, and RPMI-8226. The antibody detected the target protein (~247.7 KDa) in HeLa, TK-10, and SNB-19 cell lysates.
Catalog Number:
CPTC-SVIL-3
RRID:
AB_2753321
Target Antigen:
Supervillin
Isotype:
IgG2c
Species:
Mouse Monoclonal Antibody
Last Updated:
01/02/2026
Antigen Recognition(s):
Recombinant Full-length
Result: High Binding
Affinity and binding kinetics of CPTC-SVIL-3 and h340 recombinant protein using biolayer interferometry. CPTC-SVIL-3 antibody was covalently immobilized on amine-reactive second-generation sensors. H340 recombinant protein, 1.95 nM, 3.9 nM, and 7.8 nM, was used as analyte. R2 = 0.997. Rate constants were calculated by applying a 2:1 (heterogeneous) interaction model (global fit, full). KD (nM) – 0.53, Ka (1/Ms) – 7.28 x 105, Kd (1/s) – 3.87 x 10-4.
Result: Negative
This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: Positive
Western Blot using CPTC-SVIL-3 as primary Ab against Supervillin H340 (rAg 00259) (lane 2). Also included are molecular wt. standards (lane 1)
Catalog Number:
CPTC-SVIL-4
RRID:
AB_2753322
Target Antigen:
Supervillin
Isotype:
IgG1
Species:
Mouse Monoclonal Antibody
Last Updated:
01/02/2026
Antigen Recognition(s):
Recombinant Full-length
Result: High Binding
Affinity and binding kinetics of CPTC-SVIL-4 and h340 recombinant protein using biolayer interferometry. CPTC-SVIL-4 antibody was covalently immobilized on amine-reactive second-generation sensors. H340 recombinant protein, 4 nM, 8 nM, and 16 nM, was used as analyte. R2 = 0.993. Rate constants were calculated by applying a 2:1 (heterogeneous) interaction model (global fit, full). KD (nM) – 3.22, Ka (1/Ms) – 1.50 x 105, Kd (1/s) – 4.85 x 10-4.
Result: Negative
This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: Positive
Western Blot using CPTC-SVIL-4 as primary Ab against Supervillin H340 (rAg 00259) (lane 2). Also included are molecular wt. standards (lane 1)
NCI Identification Number:
00259
Antigen Name:
Supervillin
CPTC Name:
CPTC-SVIL
Aliases:
Supervillin; Archvillin; P205/P250; Membrane-Associated F-Actin Binding Protein P205
Function:
This gene encodes a bipartite protein with distinct amino- and carboxy-terminal domains. The amino-terminus contains nuclear localization signals and the carboxy-terminus contains numerous consecutive sequences with extensive similarity to proteins in the gelsolin family of actin-binding proteins, which cap, nucleate, and/or sever actin filaments. The gene product is tightly associated with both actin filaments and plasma membranes, suggesting a role as a high-affinity link between the actin cytoskeleton and the membrane. The encoded protein appears to aid in both myosin II assembly during cell spreading and disassembly of focal adhesions. Several transcript variants encoding different isoforms of supervillin have been described.
SVIL (Supervillin) is a Protein Coding gene. Among its related pathways are Coregulation of Androgen receptor activity. Gene Ontology (GO) annotations related to this gene include actin binding and actin filament binding. An important paralog of this gene is FLII.
Isoform 1: Forms a high-affinity link between the actin cytoskeleton and the membrane. Is among the first costameric proteins to assemble during myogenesis and it contributes to myogenic membrane structure and differentiation (PubMed:12711699). Appears to be involved in myosin II assembly. May modulate myosin II regulation through MLCK during cell spreading, an initial step in cell migration. May play a role in invadopodial function (PubMed:19109420).
Isoform 2: May be involved in modulation of focal adhesions. Supervillin-mediated down-regulation of focal adhesions involves binding to TRIP6. Plays a role in cytokinesis through KIF14 interaction (By similarity).
Chromosomal Localization:
10p11.23
Expression System:
E.coli
Accession Number:
NM_001323599.1
UniProt Accession Number:
O95425
DNA Source:
N/A
Immunogen:
Recombinant Domain
Vector Name:
xx
Extinction Coefficient:
Buffers:
Expressed Sequence:
mkrkeriarrlegiendtqpillqsctglvthrlleedtprymrasdpas
phigrsneeeetsdsslekqtrskyctetsgvhgdspygsgtmdthsles
kaeriarykaerrrqlaekygltldpeadseylsrytksrkepdavekrg
gksdkqeessrdasslypgtetmglrtcageskdyalhvgdgssdpevll
nienqrrgqelsatrqahdlspaaessstfsfsgrdssftevprspkhah
ssslqqaasrspsfgdpqlspearprctshsetptvddeekvderaklsv
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
37400
Last Updated:
05/17/2018
No SOPs available.
Get it for free at Adobe.com