Spermidine or Spermine N1-Acetyltransferase 1


Background

Catalog Number:

CPTC-SAT1-1

Target Antigen:

Spermidine or Spermine N1-Acetyltransferase 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image This summarizes the kinetic data obtained with CPTC-SAT1-1 Click image to enlarge

Kinetic Data for CPTC-SAT1-1

Result: Positive

This summarizes the kinetic data obtained with CPTC-SAT1-1


  Affinity Measurement by SPR
Download This file summarizes pairing studies by SPR. (792.1 KB)

Antibody Pairing Summary

Result: Positive

This file summarizes pairing studies by SPR.


  IHC NCI60

CPTC-SAT1-1 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-SAT1-1 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SAT1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-SAT1-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SAT1-1 as primary Ab against rAg 10026 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SAT1-1 Western Blot

Result: Positive

Western Blot using CPTC-SAT1-1 as primary Ab against rAg 10026 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

Background

Catalog Number:

CPTC-SAT1-2

Target Antigen:

Spermidine or Spermine N1-Acetyltransferase 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image This summarizes the kinetic data for CPTC-SAT1-2 Click image to enlarge

Kinetic Data for CPTC-SAT1-2

Result: Positive

This summarizes the kinetic data for CPTC-SAT1-2


  Affinity Measurement by SPR
Download This file summarizes pairing studies by SPR. (792.1 KB)

Antibody Pairing Summary

Result: Positive

This file summarizes pairing studies by SPR.


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (94.7 KB)

CPTC SAT1-2 Evaluation by Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-SAT1-2 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-SAT1-2 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SAT1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-SAT1-2 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SAT1-2 as primary Ab against rAg 10026 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SAT1-2 Western Blot

Result: Positive

Western Blot using CPTC-SAT1-2 as primary Ab against rAg 10026 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

Background

Catalog Number:

CPTC-SAT1-3

Target Antigen:

Spermidine or Spermine N1-Acetyltransferase 1

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image This summarizes the kinetic data for CPTC-SAT1-3 Click image to enlarge

Kinetic Data for CPTC-SAT1-3

Result: Positive

This summarizes the kinetic data for CPTC-SAT1-3


  Affinity Measurement by SPR
Download This file summarizes pairing studies by SPR. (792.1 KB)

Antibody Pairing Summary

Result: Positive

This file summarizes pairing studies by SPR.


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (103.2 KB)

CPTC-SAT1-3 Evaluation by Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SAT1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-SAT1-3 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SAT1-3 as primary Ab against rAg 10026 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SAT1-3 Western Blot

Result: Positive

Western Blot using CPTC-SAT1-3 as primary Ab against rAg 10026 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10026

Antigen Name:

Spermidine or Spermine N1-Acetyltransferase 1

CPTC Name:

CPTC-SAT1

Keywords:

SAT1; SAT; SAT-1; SSAT; SSAT-1; DC21; KFSD; OTTHUMP00000023061

Function:

Spermidine/spermine N(1)-acetyltransferase (SSAT; EC 2.3.1.57) is a rate-limiting enzyme in the catabolic pathway of polyamine metabolism. It catalyzes the N(1)-acetylation of spermidine and spermine and, by the successive activity of polyamine oxidase, spermine can be converted to spermidine and spermidine to putrescine

High affinity uptake of sulfate. Accepts oxalate, but not succinate as a cosubstrate (By similarity).

Chromosomal Localization:

Xp22.1

Expression System:

E. Coli

NCBI Accession Number:

BC002503

Swiss Prot Accession Number:

Q9H2B4

DNA Source:

INV : 6169298

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

37025

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFG
EHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVM
SDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASD
LSSEEGWRLFKIDKEYLLKMATEE

Native Sequence:

MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHP
FYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDY
RGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSS
EEGWRLFKIDKEYLLKMATEE

Calculated Isoelectric Point:

5.09

Molecular Weight:

20296

Last Updated:

10/24/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of SAT1 (rAg 10026) with molecular weight standards (lane 1)
Click image to enlarge

CPTC-SAT1 PAGE

PAGE of SAT1 (rAg 10026) with molecular weight standards (lane 1)

No SOPs available.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com