Ras-related C3 botulinum toxin substrate 1 (rho family small GTP binding protein Rac1)


Background

Catalog Number:

CPTC-RAC1-1

Target Antigen:

Ras-related C3 botulinum toxin substrate 1 (rho family small GTP binding protein Rac1)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/25/2013

Antigen Recognition(s):

recombinant full-length

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot Using CPTC-RAC1-1 as primary Ab against Ag 10295(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-RAC1-1 Western Blot

Western Blot Using CPTC-RAC1-1 as primary Ab against Ag 10295(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-RAC1-1 Click image to enlarge

CPTC-RAC1-1 Indirect ELISA

Indirect ELISA of CPTC-RAC1-1

  NCI 60 Protein Array

CPTC-RAC1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-RAC1-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-RAC1-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-RAC1-2

Target Antigen:

Ras-related C3 botulinum toxin substrate 1 (rho family small GTP binding protein Rac1)

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot Using CPTC-RAC1-2 as primary Ab against Ag 10295(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-RAC1-2 Western Blot

Western Blot Using CPTC-RAC1-2 as primary Ab against Ag 10295(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-RAC1-2 Click image to enlarge

CPTC-RAC1-2 Indirect ELISA

Indirect ELISA of CPTC-RAC1-2

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-RAC1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Click image to enlarge

CPTC-RAC1-2 NCI 60 Protein Array

Protein Array in which CPTC-RAC1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-RAC1-2 for NCI60  Cell Line Array at titer 1:50
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG
Click image to enlarge

CPTC-RAC1-2 IHC NCI60

Immuno-histochemistry of CPTC-RAC1-2 for NCI60 Cell Line Array at titer 1:50
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
Background

NCI Identification Number:

10295

Antigen Name:

Ras-related C3 botulinum toxin substrate 1 (rho family small GTP binding protein Rac1)

CPTC Name:

CPTC-RAC1

Keywords:

RAC1; MGC111543; MIG5; PAK1; TC-25; p21-Rac1

Function:

Isoform B has an accelerated GEF-independent GDP/GTP exchange and an impaired GTP hydrolysis, which is restored partially by GTPase-activating proteins. It is able to bind to the GTPase-binding domain of PAK but not full-length PAK in a GTP-dependent manner, suggesting that the insertion does not completely abolish effector interaction

Chromosomal Localization:

7p22

Expression System:

E. Coli

NCBI Accession Number:

BC004247

Swiss Prot Accession Number:

P63000

DNA Source:

HIP:HsCD00003506

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

23108

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVD
GKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKW
YPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLIPITYPQGLAMAK
EIGAVKYLECSAL TQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Native Sequence:

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP
VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE
VRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLIPITYPQGLAMAKEIG
AVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Calculated Isoelectric Point:

8.77

Molecular Weight:

21734

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Immuno-histochemistry of CPTC-RAC1-2 for NCI60  Cell Line Array at titer 1:50
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG
Click image to enlarge

Ag 10295

PAGE of Ag 10295 with molecular weight standards

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com