26S proteasome non-ATPase regulatory subunit 4


Background

Catalog Number:

CPTC-PSMD4-1

Target Antigen:

26S proteasome non-ATPase regulatory subunit 4

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

02/28/2013

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PSMD4-1 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-PSMD4-1 Western blot

Western Blot using CPTC-PSMD4-1 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSMD4-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-PSMD4-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4). Click image to enlarge

CPTC-PSMD4-1 Cell Lysate Western blot

Western Blot using CPTC-PSMD4-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).

  NCI 60 Protein Array

CPTC-PSMD4-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (91.2 KB)

CPTC-PSMD4-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

  IHC Tissue

CPTC-PSMD4-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC NCI60

CPTC-PSMD4-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-PSMD4-2

Target Antigen:

26S proteasome non-ATPase regulatory subunit 4

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

01/24/2013

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSMD4-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-PSMD4-2 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-PSMD4-2 Western blot

Western Blot using CPTC-PSMD4-2 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-PSMD4-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4). Click image to enlarge

CPTC-PSMD4-2 Cell Lysate Western blot

Western Blot using CPTC-PSMD4-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PSMD4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PSMD4-2 Protein Array

Protein Array in which CPTC-PSMD4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (86.2 KB)

CPTC-PSMD4-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-PSMD4-3

Target Antigen:

26S proteasome non-ATPase regulatory subunit 4

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2013

Antigen Recognition(s):

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSMD4-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-PSMD4-3 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-PSMD4-3 Western blot

Western Blot using CPTC-PSMD4-3 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-PSMD4-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4). Click image to enlarge

CPTC-PSMD4-3 Cell Lysate Western blot

Western Blot using CPTC-PSMD4-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PSMD4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PSMD4-3 Protein Array

Protein Array in which CPTC-PSMD4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (103.7 KB)

CPTC-PSMD4-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer  showing cytoplasmic staining using Antibody CPTC-PSMD4-3. Titer: 1:500 Click image to enlarge

CPTC-PSMD4-3 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PSMD4-3. Titer: 1:500

Background

NCI Identification Number:

11015

Antigen Name:

26S proteasome non-ATPase regulatory subunit 4

CPTC Name:

CPTC-PSMD4

Keywords:

AF; AF-1; ASF; MCB1; OTTHUMP00000014286; OTTHUMP00000059963; Rpn10; S5A; angiocidin; pUB-R5

Function:

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. Pseudogenes have been identified on chromosomes 10 and 21.

Binds and presumably selects ubiquitin-conjugates for destruction. Displays selectivity for longer polyubiquitin chains. Modulates intestinal fluid secretion.

Chromosomal Localization:

1q21.2

Expression System:

E. Coli

NCBI Accession Number:

BC072008.1

Swiss Prot Accession Number:

P55036

DNA Source:

OB : MHS1011-98054211

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

4595

Buffers:

PBS

Expressed Sequence:

SNAMVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPEN
NVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLAL
KHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEE
VNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAML
GLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAG
IATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQG
AEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDP
NNEAIRNAMGSLASQATKDGKKDKKEEDKK

Native Sequence:

MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVG
LITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHR
QGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNT
EKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLG
ASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIAT
TGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEF
GQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE
AIRNAMGSLASQATKDGKKDKKEEDKK

Calculated Isoelectric Point:

4.68

Molecular Weight:

40.74

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image PAGE of PSMD4 (Ag 11015) with molecular weight standards in lane 1
Click image to enlarge

CPTC-PSMD4 SDS-PAGE

PAGE of PSMD4 (Ag 11015) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com