26S Proteasome Non-ATPase Regulatory Subunit 4


Background

Catalog Number:

CPTC-PSMD4-1

RRID:

AB_10659457

Target Antigen:

26S Proteasome Non-ATPase Regulatory Subunit 4

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

05/28/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
Characterization Data [Compare Characterization Data]
  CyTOF
Click to enlarge image Imaging mass cytometry on breast cancer tissue core using CPTC-PSMD4-1 metal-labeled antibody.  Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (endometrium and appendix) and cancer tissues (breast, colon, ovarian, lung, and prostate). Click image to enlarge

CPTC-PSMD4-1 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on breast cancer tissue core using CPTC-PSMD4-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (endometrium and appendix) and cancer tissues (breast, colon, ovarian, lung, and prostate).


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (91.2 KB)

CPTC-PSMD4-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-PSMD4-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-PSMD4-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSMD4-1 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array

CPTC-PSMD4-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-PSMD4-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4). Click image to enlarge

CPTC-PSMD4-1 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-PSMD4-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PSMD4-1 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-PSMD4-1 Western blot

Result: Positive

Western Blot using CPTC-PSMD4-1 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Background

Catalog Number:

CPTC-PSMD4-2

RRID:

AB_10659874

Target Antigen:

26S Proteasome Non-ATPase Regulatory Subunit 4

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

08/03/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (86.2 KB)

CPTC-PSMD4-2 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSMD4-2 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PSMD4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PSMD4-2 Protein Array

Result: Positive

Protein Array in which CPTC-PSMD4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-PSMD4-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4). Click image to enlarge

CPTC-PSMD4-2 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-PSMD4-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PSMD4-2 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-PSMD4-2 Western blot

Result: Positive

Western Blot using CPTC-PSMD4-2 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Background

Catalog Number:

CPTC-PSMD4-3

RRID:

AB_10659719

Target Antigen:

26S Proteasome Non-ATPase Regulatory Subunit 4

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

05/28/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Characterization Data [Compare Characterization Data]
  CyTOF
Click to enlarge image Imaging mass cytometry on colon cancer tissue core using CPTC-PSMD4-3 metal-labeled antibody.  Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (breast, colon, ovarian, lung, and prostate). Click image to enlarge

CPTC-PSMD4-3 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on colon cancer tissue core using CPTC-PSMD4-3 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (breast, colon, ovarian, lung, and prostate).


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (103.7 KB)

CPTC-PSMD4-3 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer  showing cytoplasmic staining using Antibody CPTC-PSMD4-3. Titer: 1:500 Click image to enlarge

CPTC-PSMD4-3 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PSMD4-3. Titer: 1:500


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. 
Human assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-PSMD4-3 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Human assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSMD4-3 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PSMD4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PSMD4-3 Protein Array

Result: Positive

Protein Array in which CPTC-PSMD4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-PSMD4-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4). Click image to enlarge

CPTC-PSMD4-3 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-PSMD4-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PSMD4-3 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-PSMD4-3 Western blot

Result: Positive

Western Blot using CPTC-PSMD4-3 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Background

NCI Identification Number:

11015

Antigen Name:

26S Proteasome Non-ATPase Regulatory Subunit 4

CPTC Name:

CPTC-PSMD4

Aliases:

AF; AF-1; ASF; MCB1; OTTHUMP00000014286; OTTHUMP00000059963; Rpn10; S5A; angiocidin; pUB-R5

Function:

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. Pseudogenes have been identified on chromosomes 10 and 21.

Binds and presumably selects ubiquitin-conjugates for destruction. Displays selectivity for longer polyubiquitin chains. Modulates intestinal fluid secretion.

Chromosomal Localization:

1q21.2

Expression System:

E. Coli

Accession Number:

BC072008.1

UniProt Accession Number:

P55036

DNA Source:

OB : MHS1011-98054211

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

4595

Buffers:

PBS

Expressed Sequence:

SNAMVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPEN
NVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLAL
KHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEE
VNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAML
GLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAG
IATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQG
AEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDP
NNEAIRNAMGSLASQATKDGKKDKKEEDKK

Native Sequence:

MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVG
LITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHR
QGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNT
EKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLG
ASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIAT
TGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEF
GQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE
AIRNAMGSLASQATKDGKKDKKEEDKK

Calculated Isoelectric Point:

4.68

Molecular Weight:

40.74

Last Updated:

08/22/2020

Links

Characterization Data

Gel

Click to enlarge image PAGE of PSMD4 (Ag 11015) with molecular weight standards in lane 1
Click image to enlarge

CPTC-PSMD4 SDS-PAGE

PAGE of PSMD4 (Ag 11015) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com