Phosphoserine Aminotransferase 1


Background

Catalog Number:

CPTC-PSAT1-1

Target Antigen:

Phosphoserine Aminotransferase 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PSAT1-1 as primary Ab against PSAT1 (Ag 10106) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PSAT1-1 Western Blot

Western Blot using CPTC-PSAT1-1 as primary Ab against PSAT1 (Ag 10106) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSAT1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-PSAT1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-PSAT1-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-PSAT1-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-PSAT1-2

Target Antigen:

Phosphoserine Aminotransferase 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

01/26/2012

Antigen Recognition(s):

recombinant full-length

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PSAT1-2 as primary Ab against PSAT1 (Ag 10106) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PSAT1-2 Western Blot

Western Blot using CPTC-PSAT1-2 as primary Ab against PSAT1 (Ag 10106) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSAT1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PSAT1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PSAT1-2 Protein Array

Protein Array in which CPTC-PSAT1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-PSAT1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50 Click image to enlarge

CPTC-PSAT1-2 IHC NCI60

Immunohistochemistry of CPTC-PSAT1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PSAT1-2. Titer: 1:50
Click image to enlarge

CPTC-PSAT1-2 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PSAT1-2. Titer: 1:50

Background

Catalog Number:

CPTC-PSAT1-3

Target Antigen:

Phosphoserine Aminotransferase 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

01/26/2012

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PSAT1-3 as primary Ab against PSAT1 (Ag 10106) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PSAT1-3 Western Blot

Western Blot using CPTC-PSAT1-3 as primary Ab against PSAT1 (Ag 10106) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSAT1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PSAT1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PSAT1-3 Protein Array

Protein Array in which CPTC-PSAT1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC NCI60
Click to enlarge image 
Immunohistochemistry of CPTC-PSAT1-3 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50 Click image to enlarge

CPTC-PSAT1-3 IHC NCI60


Immunohistochemistry of CPTC-PSAT1-3 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PSAT1-3. Titer: 1:50 Click image to enlarge

CPTC-PSAT1-3 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PSAT1-3. Titer: 1:50

Background

Catalog Number:

CPTC-PSAT1-4

Target Antigen:

Phosphoserine Aminotransferase 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSAT1-4 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  NCI 60 Protein Array

CPTC-PSAT1-4 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-PSAT1-4 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-PSAT1-4 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

NCI Identification Number:

10106

Antigen Name:

Phosphoserine Aminotransferase 1

CPTC Name:

CPTC-PSAT1

Keywords:

PSAT; PSA; OTTHUMP00000021524; OTTHUMP00000021525; MGC1460; EPIP; EC 2.6.1.52

Function:

The protein encoded by this gene is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine.

Chromosomal Localization:

9q21.2

Expression System:

E. Coli

NCBI Accession Number:

BC004863

Swiss Prot Accession Number:

Q9Y617

DNA Source:

HIP : HsCD00003584

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

36058

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSS
DFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGR
CADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDAS
YVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAG
AQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFS
IYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQN
RSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYN
AVTIEDVQKLAAFMKKFLEMHQL

Native Sequence:

MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFA
KIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCAD
YVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVY
YCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQK
NVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYV
MGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSK
MNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVT
IEDVQKLAAFMKKFLEMHQL

Calculated Isoelectric Point:

7.54

Molecular Weight:

40695

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click image to enlarge

CPTC-PSAT1 PAGE

PAGE of PSAT1 (AG 10106) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com