Phosphoserine Aminotransferase 1


Background

Catalog Number:

CPTC-PSAT1-1

Target Antigen:

Phosphoserine Aminotransferase 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-PSAT1-1 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-PSAT1-1 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSAT1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array

CPTC-PSAT1-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PSAT1-1 as primary Ab against PSAT1 (Ag 10106) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PSAT1-1 Western Blot

Result: Positive

Western Blot using CPTC-PSAT1-1 as primary Ab against PSAT1 (Ag 10106) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-PSAT1-2

Target Antigen:

Phosphoserine Aminotransferase 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-PSAT1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50 Click image to enlarge

CPTC-PSAT1-2 IHC NCI60

Result: Positive

Immunohistochemistry of CPTC-PSAT1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PSAT1-2. Titer: 1:50
Click image to enlarge

CPTC-PSAT1-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PSAT1-2. Titer: 1:50


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSAT1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PSAT1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PSAT1-2 Protein Array

Result: Positive

Protein Array in which CPTC-PSAT1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PSAT1-2 as primary Ab against PSAT1 (Ag 10106) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PSAT1-2 Western Blot

Result: Positive

Western Blot using CPTC-PSAT1-2 as primary Ab against PSAT1 (Ag 10106) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-PSAT1-3

Target Antigen:

Phosphoserine Aminotransferase 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60
Click to enlarge image 
Immunohistochemistry of CPTC-PSAT1-3 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50 Click image to enlarge

CPTC-PSAT1-3 IHC NCI60

Result: Positive


Immunohistochemistry of CPTC-PSAT1-3 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PSAT1-3. Titer: 1:50 Click image to enlarge

CPTC-PSAT1-3 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PSAT1-3. Titer: 1:50


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSAT1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PSAT1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PSAT1-3 Protein Array

Result: Positive

Protein Array in which CPTC-PSAT1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PSAT1-3 as primary Ab against PSAT1 (Ag 10106) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PSAT1-3 Western Blot

Result: Positive

Western Blot using CPTC-PSAT1-3 as primary Ab against PSAT1 (Ag 10106) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-PSAT1-4

Target Antigen:

Phosphoserine Aminotransferase 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-PSAT1-4 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-PSAT1-4 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSAT1-4 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-PSAT1-4 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Background

NCI Identification Number:

10106

Antigen Name:

Phosphoserine Aminotransferase 1

CPTC Name:

CPTC-PSAT1

Keywords:

PSAT; PSA; OTTHUMP00000021524; OTTHUMP00000021525; MGC1460; EPIP; EC 2.6.1.52

Function:

The protein encoded by this gene is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine.

Chromosomal Localization:

9q21.2

Expression System:

E. Coli

NCBI Accession Number:

BC004863

Swiss Prot Accession Number:

Q9Y617

DNA Source:

HIP : HsCD00003584

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

36058

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSS
DFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGR
CADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDAS
YVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAG
AQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFS
IYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQN
RSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYN
AVTIEDVQKLAAFMKKFLEMHQL

Native Sequence:

MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFA
KIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCAD
YVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVY
YCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQK
NVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYV
MGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSK
MNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVT
IEDVQKLAAFMKKFLEMHQL

Calculated Isoelectric Point:

7.54

Molecular Weight:

40695

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of PSAT1 (AG 10106) with molecular weight standards in lane 1
Click image to enlarge

CPTC-PSAT1 PAGE

PAGE of PSAT1 (AG 10106) with molecular weight standards in lane 1

No SOPs available.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com