PRINT

PDZ and LIM Domain 1

Antibody: CPTC-PDLIM1-1
Background

Catalog Number:

CPTC-PDLIM1-1

RRID:

AB_10805147

Target Antigen:

PDZ and LIM Domain 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/14/2022

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Publications
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download These are the results of SPR pairing experiments with PDLIM1 antibodies. (792.1 KB)

SPR pairing results

Result: Positive

These are the results of SPR pairing experiments with PDLIM1 antibodies.


Characterization SOP Files

  Affinity Measurement by SPR

CPTC-PDLIM1-1 Affinity and Kinetics

Result: Negative

Affinity and binding kinetics of CPTC-PDLIM1-1 antibody and PDLIM1 recombinant protein using surface plasmon resonance. CPTC-PDLIM1-1 antibody was amine coupled onto a Series S CM5 biosensor chip. PDLIM1 recombinant protein, 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, 0.25 nM and 0.0625 nM was used as analyte.


Characterization SOP Files

  Affinity Measurement by SPR

CPTC-PDLIM1-1 Affinity and Kinetics

Result: Negative

Affinity and binding kinetics of CPTC-PDLIM1-1 antibody and PDLIM1 recombinant protein using surface plasmon resonance. CPTC-PDLIM1-1 antibody was captured onto a Series S Protein G biosensor chip. PDLIM1 recombinant protein, 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, 0.25 nM and 0.0625 nM, was used as analyte.


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (158.7 KB)

CPTC-PDLIM1-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60

CPTC-PDLIM1-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PDLIM1-1. Titer: 1:18000 Click image to enlarge

CPTC-PDLIM1-1 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PDLIM1-1. Titer: 1:18000


Characterization SOP Files

  Immunofluorescence
Click to enlarge image Immunofluorescence staining of human cell line MCF7 using CPTC-PDLIM1-1 antibody (green). PDLIM1 protein expression shows localization to the cytoplasm and cytoskeleton. Click image to enlarge

CPTC-PDLIM1-1 Immunofluorescence

Result: Positive

Immunofluorescence staining of human cell line MCF7 using CPTC-PDLIM1-1 antibody (green). PDLIM1 protein expression shows localization to the cytoplasm and cytoskeleton.


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line HeLa shows localization to actin filaments. Human assay: HeLa fixed with PFA, dilution: 1:2000 Human assay: MCF7 fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-PDLIM1-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line HeLa shows localization to actin filaments.
Human assay: HeLa fixed with PFA, dilution: 1:2000
Human assay: MCF7 fixed with PFA, dilution: 1:2000


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-PDLIM1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-PDLIM1-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500 Click image to enlarge

CPTC-PDLIM1-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-PDLIM1-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PDLIM1 (NCI 10044) in (lane 2). Click image to enlarge

CPTC-PDLIM1-1 Cell Lysate blot

Result: Presumed Positive (with additional bands)

Western Blot using CPTC-PDLIM1-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PDLIM1 (NCI 10044) in (lane 2).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PDLIM1-1 as primary Ab against PDLIM1 (rAg 10044) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PDLIM1-1 Western blot

Result: Positive

Western Blot using CPTC-PDLIM1-1 as primary Ab against PDLIM1 (rAg 10044) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-PDLIM1-1 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 36 KDa. ECL detection. Negative for all cell lines. Click image to enlarge

CPTC-PDLMI1-1

Result: Positive

Western Blot using CPTC-PDLIM1-1 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 36 KDa. ECL detection. Negative for all cell lines.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Automated Western Blot using CPTC-PDLIM1-1 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 36 KDa. ECL detection. Negative for all cell lines. Click image to enlarge

CPTC-PDLMI1-1 cell lysate automated WB

Result: Positive

Automated Western Blot using CPTC-PDLIM1-1 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 36 KDa. ECL detection. Negative for all cell lines.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Single cell western blot using CPTC-PDLIM1-1 as a primary antibody against cell lysates. Relative expression of total PDLIM1 in MCF7 cells (A). Percentage of cells that express PDLIM1 (B). Average expression of PDLIM1 protein per cell (C). All data is normalized to β-tubulin expression. Click image to enlarge

CPTC-PDLIM1-1 Single Cell Western Blot (Cell Lysate)

Result: Positive

Single cell western blot using CPTC-PDLIM1-1 as a primary antibody against cell lysates. Relative expression of total PDLIM1 in MCF7 cells (A). Percentage of cells that express PDLIM1 (B). Average expression of PDLIM1 protein per cell (C). All data is normalized to β-tubulin expression.


Characterization SOP Files

[top]

Antibody: CPTC-PDLIM1-2
Background

Catalog Number:

CPTC-PDLIM1-2

RRID:

AB_10804169

Target Antigen:

PDZ and LIM Domain 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

08/25/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download These are the results of SPR pairing experiments with PDLIM1 antibodies. (792.1 KB)

SPR pairing results

Result: Positive

These are the results of SPR pairing experiments with PDLIM1 antibodies.


Characterization SOP Files

  IHC HPA

CPTC-PDLIM1-2 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-PDLIM1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PDLIM1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PDLIM1-2 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-PDLIM1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-PDLIM1-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PDLIM1 (NCI 10044) in (lane 2). Click image to enlarge

CPTC-PDLIM1-2 Cell Lysate blot

Result: Positive

Western Blot using CPTC-PDLIM1-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PDLIM1 (NCI 10044) in (lane 2).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PDLIM1-2 as primary Ab against PDLIM1 (rAg 10044) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PDLIM1-2 Western blot

Result: Positive

Western Blot using CPTC-PDLIM1-2 as primary Ab against PDLIM1 (rAg 10044) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-PDLIM1-3
Background

Catalog Number:

CPTC-PDLIM1-3

RRID:

AB_10805152

Target Antigen:

PDZ and LIM Domain 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/21/2023

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Publications
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download These are the results of SPR pairing experiments with PDLIM1 antibodies. (792.1 KB)

SPR pairing results

Result: Positive

These are the results of SPR pairing experiments with PDLIM1 antibodies.


Characterization SOP Files

  Affinity Measurement by SPR
Click to enlarge image Affinity and binding kinetics of CPTC-PDLIM1-3 antibody and PDLIM1 recombinant protein using surface plasmon resonance. CPTC-PDLIM1-3 antibody was amine coupled onto a Series S CM5 biosensor chip. PDLIM1 recombinant protein, 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM and 1 nM, was used as analyte. Click image to enlarge

CPTC-PDLIM1-3 Affinity and Kinetics

Result: Positive

Affinity and binding kinetics of CPTC-PDLIM1-3 antibody and PDLIM1 recombinant protein using surface plasmon resonance. CPTC-PDLIM1-3 antibody was amine coupled onto a Series S CM5 biosensor chip. PDLIM1 recombinant protein, 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM and 1 nM, was used as analyte.


Characterization SOP Files

  Affinity Measurement by SPR
Click to enlarge image Affinity and binding kinetics of CPTC-PDLIM1-3 antibody and PDLIM1 recombinant protein using surface plasmon resonance. CPTC-PDLIM1-3 antibody was captured onto a Series S Protein G biosensor chip. PDLIM1 recombinant protein, 256 nM, 64 nM, 16 nM, 4 nM and 1 nM, was used as analyte. Click image to enlarge

CPTC-PDLIM1-3 Affinity and Kinetics

Result: Positive

Affinity and binding kinetics of CPTC-PDLIM1-3 antibody and PDLIM1 recombinant protein using surface plasmon resonance. CPTC-PDLIM1-3 antibody was captured onto a Series S Protein G biosensor chip. PDLIM1 recombinant protein, 256 nM, 64 nM, 16 nM, 4 nM and 1 nM, was used as analyte.


Characterization SOP Files

  IHC NCI60

CPTC-PDLIM1-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  IHC Tissue

CPTC-PDLIM1-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  Immunofluorescence

CPTC-PDLIM1-3 Immunofluorescence

Result: Negative

Immunofluorescence staining of human cell line MCF7 with CPTC-PDLIM1-3 Ab shows no localization of PDLIM1 protein.


Characterization SOP Files

  Immunofluorescence

CPTC-PDLIM1-3 Immunofluorescence

Result: Negative

Immunofluorescence staining of HeLa cells using CPTC-PDLIM1-3 antibody. PDLIM1 protein expression was not detected.


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line HeLa shows localization to plasma membrane & actin filaments. Human assay: HeLa fixed with PFA, dilution: 1:2000 Human assay: MCF7 fixed with PFA, dilution: 1:2000 Human assay: U-2 OS fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-PDLIM1-3 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line HeLa shows localization to plasma membrane & actin filaments.
Human assay: HeLa fixed with PFA, dilution: 1:2000
Human assay: MCF7 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-PDLIM1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-PDLIM1-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-PDLIM1-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PDLIM1 (NCI 10044) in (lane 2). Click image to enlarge

CPTC-PDLIM1-3 Cell Lysate blot

Result: Positive

Western Blot using CPTC-PDLIM1-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PDLIM1 (NCI 10044) in (lane 2).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PDLIM1-3 as primary Ab against PDLIM1 (rAg 10044) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PDLIM1-3 Western blot

Result: Positive

Western Blot using CPTC-PDLIM1-3 as primary Ab against PDLIM1 (rAg 10044) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-PDLIM1-3 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 36 KDa. ECL detection. Positive for HeLa, A549, MCF7 and H226. Click image to enlarge

CPTC-PDLMI1-3 cell lysate WB

Result: Positive

Western Blot using CPTC-PDLIM1-3 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 36 KDa. ECL detection. Positive for HeLa, A549, MCF7 and H226.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Automated Western Blot using CPTC-PDLIM1-3 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 36 KDa. ECL detection. Positive for HeLa, A549 and H226. Click image to enlarge

CPTC-PDLMI1-3 cell lysate automated WB

Result: Positive

Automated Western Blot using CPTC-PDLIM1-3 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 36 KDa. ECL detection. Positive for HeLa, A549 and H226.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Single cell western blot using CPTC-PDLIM1-3 as a primary antibody against cell lysates. Relative expression of total PDLIM1 in MCF7 cells (A). Percentage of cells that express PDLIM1 (B). Average expression of PDLIM1 protein per cell (C). All data is normalized to β-tubulin expression. Click image to enlarge

CPTC-PDLIM1-3 Single Cell Western Blot (Cell Lysate)

Result: Positive

Single cell western blot using CPTC-PDLIM1-3 as a primary antibody against cell lysates. Relative expression of total PDLIM1 in MCF7 cells (A). Percentage of cells that express PDLIM1 (B). Average expression of PDLIM1 protein per cell (C). All data is normalized to β-tubulin expression.


Characterization SOP Files

[top]

Antigen: PDZ and LIM Domain 1
Background

NCI Identification Number:

10044

Antigen Name:

PDZ and LIM Domain 1

CPTC Name:

CPTC-PDLIM1

Aliases:

PDZ and LIM domain 1; CLP36; CLIM1; hCLIM1; CLP-36; C-terminal LIM domain protein 1; LIM domain protein CLP-36

Function:

Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton

Chromosomal Localization:

10q23.1

Expression System:

E. Coli

Accession Number:

BC000915.1

UniProt Accession Number:

O00151

DNA Source:

Invitrogen - 2985229

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

21430

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAMTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIG
DVITAIDGENTSNMTHLEAQNRIKGCTDNLTLTVARSEHKVWSPLVTEEG
KRHPYKMNLASEPQEVLHIGSAHNRSAMPFTASPASSTTARVITNQYNNP
AGLYSSENISNFNNALESKTAASGVEANSRPLDHAQPPSSLVIDKESEVY
KMLQEKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKV
AASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKG
HFFVEDQIYCEKHARERVTPPEGYEVVTVFPK

Native Sequence:

MTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVI
TAIDGENTSNMTHLEAQNRIKGCTDNLTLTVARSEHKVWSPLVTEEGKRH
PYKMNLASEPQEVLHIGSAHNRSAMPFTASPASSTTARVITNQYNNPAGL
YSSENISNFNNALESKTAASGVEANSRPLDHAQPPSSLVIDKESEVYKML
QEKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAAS
IGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFF
VEDQIYCEKHARERVTPPEGYEVVTVFPK

Calculated Isoelectric Point:

6.56

Molecular Weight:

36072

Last Updated:

05/04/2011

Links

Characterization Data

Gel

Click to enlarge image PAGE of PDLIM1 (rAg 10044) with molecular weight standards in lane 1
Click image to enlarge

CPTC-PDLIM1 PAGE

PAGE of PDLIM1 (rAg 10044) with molecular weight standards in lane 1

[top]

SOPs

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]