PRINT

Nucleoside Diphosphate Kinase A (nm23-H1)

Antibody: CPTC-NME1-2
Background

Catalog Number:

CPTC-NME1-2

RRID:

AB_10572886

Target Antigen:

Nucleoside Diphosphate Kinase A (nm23-H1)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

05/28/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image This table shows the cross reactivity data for NME1 and NME2. Click image to enlarge

Cross Reactivity Studies

Result: Positive

This table shows the cross reactivity data for NME1 and NME2.


Characterization SOP Files

  CyTOF
Click to enlarge image Imaging mass cytometry on normal colon tissue core using CPTC-NME1-2 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, prostate, colon, pancreas, breast, lung, testis, endometrium, and appendix) and cancer tissues (breast, colon, ovarian, lung, and prostate). Click image to enlarge

CPTC-NME1-2 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on normal colon tissue core using CPTC-NME1-2 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, prostate, colon, pancreas, breast, lung, testis, endometrium, and appendix) and cancer tissues (breast, colon, ovarian, lung, and prostate).


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (339.2 KB)

CPTC-NME1-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-NME1-2 for NCI60 Cell Line Array. Data scored as: 0=NEGATIVE 1=WEAK (red) 2=MODERATE (blue) 3=STRONG (green) Titer: 1:50 Click image to enlarge

CPTC-NME1-2 IHC NCI60

Result: Positive

Immunohistochemistry of CPTC-NME1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-NME1-2. Titer: 1:50 Click image to enlarge

CPTC-NME1-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-NME1-2. Titer: 1:50


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:20 Human assay: U-2 OS fixed with PFA, dilution: 1:20 Human assay: U-251 MG fixed with PFA, dilution: 1:20 Click image to enlarge

CPTC-NME1-2 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:20
Human assay: U-2 OS fixed with PFA, dilution: 1:20
Human assay: U-251 MG fixed with PFA, dilution: 1:20


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-NME1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-NME1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-NME1-2 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-NME1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:250. Click image to enlarge

CPTC-NME1-2 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:250.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-NME1-2 as primary Ab against NME1 (Ag 10263) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NME1-2 Western Blot

Result: Positive

Western Blot using CPTC-NME1-2 as primary Ab against NME1 (Ag 10263) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-NME1-3
Background

Catalog Number:

CPTC-NME1-3

RRID:

AB_2152853

Target Antigen:

Nucleoside Diphosphate Kinase A (nm23-H1)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

09/01/2022

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image This table shows the cross reactivity between NME1 and NME2. Click image to enlarge

Cross Reactivity Studies

Result: Positive

This table shows the cross reactivity between NME1 and NME2.


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (439.7 KB)

CPTC-NME1-3 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60

CPTC-NME1-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  IHC Tissue

CPTC-NME1-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  Immunofluorescence - HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (439.7 KB)

CPTC-NME1-3 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-NME1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-NME1-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-NME1-3 as primary Ab against NME1 (Ag 10263) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NME1-3 Western Blot

Result: Positive

Western Blot using CPTC-NME1-3 as primary Ab against NME1 (Ag 10263) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-NME1-4
Background

Catalog Number:

CPTC-NME1-4

RRID:

AB_2617300

Target Antigen:

Nucleoside Diphosphate Kinase A (nm23-H1)

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

09/01/2022

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (597.8 KB)

CPTC-NME1-4 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60

CPTC-NME1-4 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  IHC Tissue

CPTC-NME1-4 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  Immunofluorescence - HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (597.8 KB)

CPTC-NME1-4 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NME1-4 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-NME1-4 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-NME1-4 as primary Ab against NME1 (rAg 10263) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NME1-4 Western blot

Result: Positive

Western Blot using CPTC-NME1-4 as primary Ab against NME1 (rAg 10263) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-NME1-5
Background

Catalog Number:

CPTC-NME1-5

RRID:

AB_2617301

Target Antigen:

Nucleoside Diphosphate Kinase A (nm23-H1)

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

09/01/2022

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (564.7 KB)

CPTC-NME1-5 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60

CPTC-NME1-5 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  IHC Tissue

CPTC-NME1-5 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  Immunofluorescence - HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (564.7 KB)

CPTC-NME1-5 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NME1-5 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-NME1-5 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-NME1-5 as primary Ab against NME1 (rAg 10263) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NME1-5 Western blot

Result: Positive

Western Blot using CPTC-NME1-5 as primary Ab against NME1 (rAg 10263) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antigen: Nucleoside Diphosphate Kinase A (nm23-H1)
Background

NCI Identification Number:

10263

Antigen Name:

Nucleoside Diphosphate Kinase A (nm23-H1)

CPTC Name:

CPTC-NME1

Aliases:

NME1; AWD; GAAD; NDPK-A; NDPKA; NM23; NM23-H1; nm23-H1; EC 2.7.4.6; OTTHUMP00000174772

Function:

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A'(encoded by this gene) and 'B'(encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

Major role in the synthesis of nucleoside triphosphates other than ATP.

Chromosomal Localization:

17q21.33

Expression System:

E. Coli

Accession Number:

BC000293

UniProt Accession Number:

P15531

DNA Source:

HIP : HsCD00001887

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

22523

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDL
LKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPA
DSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQ
NWIYE

Native Sequence:

MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKE
HYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSK
PGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWI
YE

Calculated Isoelectric Point:

5.83

Molecular Weight:

17421

Last Updated:

01/11/2021

Links

Characterization Data

SOPs

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]