Neurofibromin 1


Background

Catalog Number:

CPTC-NF1-1

RRID:

AB_2920914

Target Antigen:

Neurofibromin 1

Isotype:

IgG3

Species:

Mouse Monoclonal Antibody

Last Updated:

08/17/2022

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
Characterization Data [Compare Characterization Data]
  IP

CPTC-NF1-1 IP-WB

Result: Negative

IP-WB performed with CPTC-NF1-1 as capture antibody against recombinant protein and MCF7 lysate. Eluates were screened in WB using antibody CPTC-NF1-1 as detection antibody. This antibody is not suitable for use in this application.


Background

Catalog Number:

CPTC-NF1-2

RRID:

AB_2920915

Target Antigen:

Neurofibromin 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

08/17/2022

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
Characterization Data [Compare Characterization Data]
  IP

CPTC-NF1-2 IP-WB

Result: Negative

IP-WB performed with CPTC-NF1-2 as capture antibody against recombinant protein and MCF7 lysate. Eluates were screened in WB using antibody CPTC-NF1-1 as detection antibody. This antibody is not suitable for use in this application.


Background

Catalog Number:

CPTC-NF1-3

RRID:

AB_2920916

Target Antigen:

Neurofibromin 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

08/17/2022

Antigen Recognition(s):

Recombinant Full-length

Purchase
Characterization Data [Compare Characterization Data]
Background

NCI Identification Number:

00489

Antigen Name:

Neurofibromin 1

CPTC Name:

CPTC-NF1

Aliases:

Neurofibromin 1; Neurofibromatosis-Related Protein NF-1; Neurofibromin; Von Recklinghausen Disease; Truncated Neurofibromin 1; Neurofibromatosis 1; Neurofibromatosis; Watson Disease; NFNS; VRNF; WSS; NF1

Function:

This gene product appears to function as a negative regulator of the ras signal transduction pathway. Mutations in this gene have been linked to neurofibromatosis type 1, juvenile myelomonocytic leukemia and Watson syndrome. The mRNA for this gene is subject to RNA editing (CGA>UGA->Arg1306Term) resulting in premature translation termination. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene.NF1 (Neurofibromin 1) is a Protein Coding gene. Diseases associated with NF1 include Neurofibromatosis-Noonan Syndrome and Neurofibromatosis, Type I. Among its related pathways are RET signaling and Signaling by GPCR. Gene Ontology (GO) annotations related to this gene include binding and phosphatidylcholine binding. An important paralog of this gene is RASA3.Stimulates the GTPase activity of Ras. NF1 shows greater affinity for Ras GAP, but lower specific activity. May be a regulator of Ras activity.

Chromosomal Localization:

17q11.2

Expression System:

Baculovirus

Accession Number:

NP_001035957.1

UniProt Accession Number:

P21359

DNA Source:

N/A

Immunogen:

Recombinant Full Length Protein

Vector Name:

xx

Extinction Coefficient:

Buffers:

Expressed Sequence:

MGSGSHHHHHHRSSITSLYKKVGENLYFQGAAHRPVEWVQAVVSRFDEQL
PIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIF
GEAAEKNLYLSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHFL
HTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDN
VDVHDIELLQYINVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFW
NWVENYPDEFTKLYQIPQTDMAECAEKLFDLVDGFAESTKRKAAVWPLQI
ILLILCPEIIQDISKDVVDENNMNKKLFLDSLRKALAGHGGSRQLTESAA
IACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNPSKPFSRGSQPA
DVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITNS
ALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPSLTFKEK
VTSLKFKEKPTDLETRSYKYLLLSMVKLIHADPKLLLCNPRKQGPETQGS
TAELITGLVQLVPQSHMPEIAQEAMEALLVLHQLDSIDLWNPDAPVETFW
EISSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNKQADRSS
CHFLLFYGVGCDIPSSGNTSQMSMDHEELLRTPGASLRKGKGNSSMDSAA
GCSGTPPICRQAQTKLEVALYMFLWNPDTEAVLVAMSCFRHLCEEADIRC
GVDEVSVHNLLPNYNTFMEFASVSNMMSTGRAALQKRVMALLRRIEHPTA
GNTEAWEDTHAKWEQATKLILNYPKAKMEDGQAAESLHKTIVKRRMSHVS
GGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSNSGLATYSPPMGPVS
ERKGSMISVMSSEGNADTPVSKFMDRLLSLMVCNHEKVGLQIRTNVKDLV
GLELSPALYPMLFNKLKNTISKFFDSQGQVLLTDTNTQFVEQTIAIMKNL
LDNHTEGSSEHLGQASIETMMLNLVRYVRVLGNMVHAIQIKTKLCQLVEV
MMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDVKCLTRDLDQA
SMEAVVSLLAGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVE
DESAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIGLGYHK
DLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGEL
PIAMALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNMFSKEVELADSM
QTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRIVITSSDWQHVSFEV
DPTRLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPPQLRSVCHCLYQV
VSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLKLM
SKILQSIANHVLFTKEEHMRPFNDFVKSNFDAARRFFLDIASDCPTSDAV
NHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRPFDKMATL
LAYLGPPEHKPVADTHWSSLNLTSSKFEEFMTRHQVHEKEEFKALKTLSI
FYQAGTSKAGNPIFYYVARRFKTGQINGDLLIYHVLLTLKPYYAKPYEIV
VDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIYNCNSWVREYTKY
HERLLTGLKGSKRLVFIDCPGKLAEHIEHEQQKLPAATLALEEDLKVFHN
ALKLAHKDTKVSIKVGSTAVQVTSAERTKVLGQSVFLNDIYYASEIEEIC
LVDENQFTLTIANQGTPLTFMHQECEAIVQSIIHIRTRWELSQPDSIPQH
TKIRPKDVPGTLLNIALLNLGSSDPSLRSAAYNLLCALTCTFNLKIEGQL
LETSGLCIPANNTLFIVSISKTLAANEPHLTLEFLEECISGFSKSSIELK
HLCLEYMTPWLSNLVRFCKHNDDAKRQRVTAILDKLITMTINEKQMYPSI
QAKIWGSLGQITDLLDVVLDSFIKTSATGGLGSIKAEVMADTAVALASGN
VKLVSSKVIGRMCKIIDKTCLSPTPTLEQHLMWDDIAILARYMLMLSFNN
SLDVAAHLPYLFHVVTFLVATGPLSLRASTHGLVINIIHSLCTCSQLHFS
EETKQVLRLSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYRDRSFSPGSY
ERETFALTSLETVTEALLEIMEACMRDIPTCKWLDQWTELAQRFAFQYNP
SLQPRALVVFGCISKRVSHGQIKQIIRILSKALESCLKGPDTYNSQVLIE
ATVIALTKLQPLLNKDSPLHKALFWVAVAVLQLDEVNLYSAGTALLEQNL
HTLDSLRIFNDKSPEEVFMAIRNPLEWHCKQMDHFVGLNFNSNFNFALVG
HLLKGYRHPSPAIVARTVRILHTLLTLVNKHRNCDKFEVNTQSVAYLAAL
LTVSEEVRSRCSLKHRKSLLLTDISMENVPMDTYPIHHGDPSYRTLKETQ
PWSSPKGSEGYLAATYPTVGQTSPRARKSMSLDMGQPSQANTKKLLGTRK
SFDHLISDTKAPKRQEMESGITTPPKMRRVAETDYEMETQRISSSQQHPH
LRKVSVSESNVLLDEEVLTDPKIQALLLTVLATLVKYTTDEFDQRILYEY
LAEASVVFPKVFPVVHNLLDSKINTLLSLCQDPNLLNPIHGIVQSVVYHE
ESPPQYQTSYLQSFGFNGLWRFAGPFSKQTQIPDYAELIVKFLDALIDTY
LPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSP
GIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV

Native Sequence:

Calculated Isoelectric Point:

7.02

Molecular Weight:

320316

Last Updated:

06/23/2021

Links

Characterization Data

SOPs

No SOPs available.

Don't have Adobe Reader™?

Get it for free at Adobe.com