Methyl CpG Binding Protein 1


Background

Catalog Number:

CPTC-MBD1-1

Target Antigen:

Methyl CpG Binding Protein 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/25/2013

Antigen Recognition(s):

recombinant full-length

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-MBD1-1 as primary Ab against Ag 10436 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MBD1-1 Western Blot

Western Blot using CPTC-MBD1-1 as primary Ab against Ag 10436 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MBD1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-MBD1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-MBD1-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-MBD1-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-MBD1-2

Target Antigen:

Methyl CpG Binding Protein 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/25/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-MBD1-2 as primary Ab against Ag 10436 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MBD1-2 Western Blot

Western Blot using CPTC-MBD1-2 as primary Ab against Ag 10436 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MBD1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-MBD1-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-MBD1-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-MBD1-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-MBD1-3

Target Antigen:

Methyl CpG Binding Protein 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

12/16/2011

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-MBD1-3 as primary Ab against Ag 10436 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MBD1-3 Western Blot

Western Blot using CPTC-MBD1-3 as primary Ab against Ag 10436 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MBD1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MBD1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-MBD1-3 Protein Array

Protein Array in which CPTC-MBD1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

Background

NCI Identification Number:

10436

Antigen Name:

Methyl CpG Binding Protein 1

CPTC Name:

CPTC-MBD1

Keywords:

MBD1; CXXC3; OTTHUMP00000163504; OTTHUMP00000163506; OTTHUMP00000163507; PCM1; RFT

Function:

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in
mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of
nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of
these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five
transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from
methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.

Transcriptional repressor that binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. Binding is abolished by the presence of 7-mG that is produced by DNA damage by methylmethanesulfonate (MMS). Acts as transcriptional repressor
and plays a role in gene silencing by recruiting AFT7IP, which in turn recruits factors such as
the histone methyltransferase SETDB1. Probably forms a complex with SETDB1 and ATF7IP that represses transcription and couples DNA methylation and histone 'Lys-9' trimethylation. Isoform 1
and isoform 2 can also repress transcription from unmethylated promoters.

Chromosomal Localization:

18q21

Expression System:

E. Coli

NCBI Accession Number:

BC000453

Swiss Prot Accession Number:

Q9UIS9

DNA Source:

HIP:HsCD00022173

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

17023

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMATGGGPFEDGMNDQDLPNWSNENVDDRLNNMDWGAQQKKANRSSEK
NKKKFGVESDKRVTNDISPESSPGVGRRRTKTPHTFPHSRYMSQMSVPEQ
AELEKLKQRINFSDLDQRSIGSDSQGRATAANNKRQLSENRKPFNFLPMQ
INTNKSKDASTSPPNRETIGSAQCKELFASALSNDLLQNCQVSEEDGRGE
PAMESSQIVSRLVQIRDYITKASSMREDLVEKNERSANVERLTHLIDHLK
EQEKSYMKFLKKILARENEEEDVRTIDSAVGSGSVAESTSLNIDVQSEAS
DTTARDPQQEPMEEIENLKKQHDLLKRMLQQQEQLRALQGRQAALLALQH
KAEQAIAVMDDSVVAETAGSLSGVSITSELNEELNDLIQRFHNQLRDSQP
PAVPDNRRQAESLSLTREVSQSRKPSASERLPDEKVELFSKMRVLQEKKQ
KMDKLLGELHTLRDQHLNNSSSSPQRSVDQRSTSAPSASVGLAPVVNGES
NSLTSSVPYPTASLVSQNESENEGHLNPSEKLQ

Native Sequence:

MATGGGPFEDGMNDQDLPNWSNENVDDRLNNMDWGAQQKKANRSSEKNKK
KFGVESDKRVTNDISPESSPGVGRRRTKTPHTFPHSRYMSQMSVPEQAEL
EKLKQRINFSDLDQRSIGSDSQGRATAANNKRQLSENRKPFNFLPMQINT
NKSKDASTSPPNRETIGSAQCKELFASALSNDLLQNCQVSEEDGRGEPAM
ESSQIVSRLVQIRDYITKASSMREDLVEKNERSANVERLTHLIDHLKEQE
KSYMKFLKKILARENEEEDVRTIDSAVGSGSVAESTSLNIDVQSEASDTT
ARDPQQEPMEEIENLKKQHDLLKRMLQQQEQLRALQGRQAALLALQHKAE
QAIAVMDDSVVAETAGSLSGVSITSELNEELNDLIQRFHNQLRDSQPPAV
PDNRRQAESLSLTREVSQSRKPSASERLPDEKVELFSKMRVLQEKKQKMD
KLLGELHTLRDQHLNNSSSSPQRSVDQRSTSAPSASVGLAPVVNGESNSL
TSSVPYPTASLVSQNESENEGHLNPSEKLQ

Calculated Isoelectric Point:

5.61

Molecular Weight:

59471

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Protein Array in which CPTC-MBD1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click image to enlarge

Ag 10436

SDS-PAGE of Ag 10295 with molecular weight standards

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com