Kirsten Rat Sarcoma Viral Oncogene Homolog


Background

Catalog Number:

CPTC-KRAS4B-1

Target Antigen:

Kirsten Rat Sarcoma Viral Oncogene Homolog

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/17/2017

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western blot of CPTC-KRAS4b-1 antibody with full length KRAS4b recombinant protein. Click image to enlarge

CPTC-KRAS4B-1 Western blot

Western blot of CPTC-KRAS4b-1 antibody with full length KRAS4b recombinant protein.

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Cross Reactivity Data
Click to enlarge image Western blot of CPTC-KRAS4b-1 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins. Click image to enlarge

CPTC-KRAS4B-1 Cross Reactivity

Western blot of CPTC-KRAS4b-1 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins.

  IPMS
Download Clone_2D2.pdf (1.4 MB)

CPTC-KRAS4B-1 IPMS

This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-1 antibody.

Background

Catalog Number:

CPTC-KRAS4B-2

Target Antigen:

Kirsten Rat Sarcoma Viral Oncogene Homolog

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

10/17/2017

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western blot of CPTC-KRAS4b-2 antibody with full length KRAS4b, recombinant protein. Click image to enlarge

CPTC-KRAS4B-2 Western blot

Western blot of CPTC-KRAS4b-2 antibody with full length KRAS4b, recombinant protein.

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Cross Reactivity Data
Click to enlarge image Western blot of CPTC-KRAS4b-2 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins. Click image to enlarge

CPTC-KRAS4B-2 Cross Reactivity

Western blot of CPTC-KRAS4b-2 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins.

  IPMS
Download Clone_4E8.pdf (1.4 MB)

CPTC-KRAS4B-2 IPMS

This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-2 antibody.

Background

Catalog Number:

CPTC-KRAS4B-3

Target Antigen:

Kirsten Rat Sarcoma Viral Oncogene Homolog

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/18/2017

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein. Click image to enlarge

CPTC-KRAS4B-3 Western blot

Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein.

  Western Blot
Click to enlarge image Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein. Click image to enlarge

CPTC-KRAS4B-3 Western blot

Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein.

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Cross Reactivity Data
Click to enlarge image Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins. Click image to enlarge

CPTC-KRAS4B-3 Cross Reactivity

Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins.

  IPMS
Download Clone_4H2.pdf (1.3 MB)

CPTC-KRAS4B-3 IPMS

This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-3 antibody.

Background

Catalog Number:

CPTC-KRAS4B-4

Target Antigen:

Kirsten Rat Sarcoma Viral Oncogene Homolog

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/17/2017

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein. Click image to enlarge

CPTC-KRAS4B-4 Western blot

Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein.

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-4 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Cross Reactivity Data
Click to enlarge image Western blot of CPTC-KRAS4b-4 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins. Click image to enlarge

CPTC-KRAS4B-4 Cross Reactivity

Western blot of CPTC-KRAS4b-4 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins.

  IPMS
Download Clone_6C10.pdf (1.3 MB)

CPTC-KRAS4B-4 IPMS

This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-4 antibody. (Note that this antibody does not pull down KRAS4A antigen.)

Background

NCI Identification Number:

00125

Antigen Name:

Kirsten Rat Sarcoma Viral Oncogene Homolog

CPTC Name:

CPTC-KRAS4B

Keywords:

Kirsten Rat Sarcoma Viral Oncogene Homolog; KRAS2; RASK2; V-Ki-Ras2 Kirsten Rat Sarcoma 2 Viral Oncogene Homolog; C-Ki-Ras; K-Ras 2; C-K-RAS; KI-RAS;CFC2; NS; V-Ki-Ras2 Kirsten Rat Sarcoma Viral Oncogene Homolog; Cellular C-Ki-Ras2 Proto-Oncogene; Transforming Protein P21; PR310 C-K-Ras Oncogene; C-Kirsten-Ras Protein; K-Ras P21 Protein; Oncogene KRAS2; GTPase KRas; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B;KRAS1; NS3

Function:

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region.

KRAS (Kirsten Rat Sarcoma Viral Oncogene Homolog) is a Protein Coding gene. Diseases associated with KRAS include noonan syndrome 3 and cardiofaciocutaneous syndrome 2. Among its related pathways are PI3K-Akt signaling pathway and PI-3K cascade. GO annotations related to this gene include GTP binding and GDP binding. An important paralog of this gene is HRAS.

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation.

Chromosomal Localization:

12p12.1

Expression System:

E. coli

NCBI Accession Number:

NP_004976.2

Swiss Prot Accession Number:

P01116

DNA Source:

R999-X117-566

Immunogen:

Recombinant Full Length Protein

Vector Name:

pDest-566

Extinction Coefficient:

Buffers:


Expressed Sequence:

GGSGTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTI
EDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTG
EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLV
GNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVD
DAFYTLVREIRKHKEKMSKDGKKKKKKSKTKCVIM

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

21552

Last Updated:

11/18/2015

Links

Characterization Data

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com