Kirsten Rat Sarcoma Viral Oncogene Homolog


Background

Catalog Number:

CPTC-KRAS4B-1

Target Antigen:

Kirsten Rat Sarcoma Viral Oncogene Homolog

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

Thematic Panel(s):

Ras Pathway

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image Western blot of CPTC-KRAS4b-1 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins. Click image to enlarge

CPTC-KRAS4B-1 Cross Reactivity

Result: Positive

Western blot of CPTC-KRAS4b-1 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins.


  IPMS
Download This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-1 antibody. (1.4 MB)

CPTC-KRAS4B-1 IPMS

Result: Positive

This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-1 antibody.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot of CPTC-KRAS4b-1 antibody with full length KRAS4b recombinant protein. Click image to enlarge

CPTC-KRAS4B-1 Western blot

Result: Positive

Western blot of CPTC-KRAS4b-1 antibody with full length KRAS4b recombinant protein.


Background

Catalog Number:

CPTC-KRAS4B-2

Target Antigen:

Kirsten Rat Sarcoma Viral Oncogene Homolog

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

Thematic Panel(s):

Ras Pathway

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image Western blot of CPTC-KRAS4b-2 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins. Click image to enlarge

CPTC-KRAS4B-2 Cross Reactivity

Result: Positive

Western blot of CPTC-KRAS4b-2 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins.


  IPMS
Download This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-2 antibody. (1.4 MB)

CPTC-KRAS4B-2 IPMS

Result: Positive

This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-2 antibody.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot of CPTC-KRAS4b-2 antibody with full length KRAS4b, recombinant protein. Click image to enlarge

CPTC-KRAS4B-2 Western blot

Result: Positive

Western blot of CPTC-KRAS4b-2 antibody with full length KRAS4b, recombinant protein.


Background

Catalog Number:

CPTC-KRAS4B-3

Target Antigen:

Kirsten Rat Sarcoma Viral Oncogene Homolog

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

Thematic Panel(s):

Ras Pathway

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins. Click image to enlarge

CPTC-KRAS4B-3 Cross Reactivity

Result: Positive

Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins.


  IPMS
Download This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-3 antibody. (1.3 MB)

CPTC-KRAS4B-3 IPMS

Result: Positive

This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-3 antibody.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein. Click image to enlarge

CPTC-KRAS4B-3 Western blot

Result: Positive

Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein. Click image to enlarge

CPTC-KRAS4B-3 Western blot

Result: Positive

Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein.


Background

Catalog Number:

CPTC-KRAS4B-4

Target Antigen:

Kirsten Rat Sarcoma Viral Oncogene Homolog

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

Thematic Panel(s):

Ras Pathway

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image Western blot of CPTC-KRAS4b-4 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins. Click image to enlarge

CPTC-KRAS4B-4 Cross Reactivity

Result: Positive

Western blot of CPTC-KRAS4b-4 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins.


  IPMS
Download This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-4 antibody. (Note that this antibody does not pull down KRAS4A antigen.) (1.3 MB)

CPTC-KRAS4B-4 IPMS

Result: Positive

This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-4 antibody. (Note that this antibody does not pull down KRAS4A antigen.)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-4 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein. Click image to enlarge

CPTC-KRAS4B-4 Western blot

Result: Positive

Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein.


Background

NCI Identification Number:

00125

Antigen Name:

Kirsten Rat Sarcoma Viral Oncogene Homolog

CPTC Name:

CPTC-KRAS4B

Keywords:

Kirsten Rat Sarcoma Viral Oncogene Homolog; KRAS2; RASK2; V-Ki-Ras2 Kirsten Rat Sarcoma 2 Viral Oncogene Homolog; C-Ki-Ras; K-Ras 2; C-K-RAS; KI-RAS; CFC2; NS; V-Ki-Ras2 Kirsten Rat Sarcoma Viral Oncogene Homolog; Cellular C-Ki-Ras2 Proto-Oncogene; Transforming Protein P21; PR310 C-K-Ras Oncogene; C-Kirsten-Ras Protein; K-Ras P21 Protein; Oncogene KRAS2; GTPase KRas; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; KRAS1; NS3

Function:

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region.

KRAS (Kirsten Rat Sarcoma Viral Oncogene Homolog) is a Protein Coding gene. Diseases associated with KRAS include noonan syndrome 3 and cardiofaciocutaneous syndrome 2. Among its related pathways are PI3K-Akt signaling pathway and PI-3K cascade. GO annotations related to this gene include GTP binding and GDP binding. An important paralog of this gene is HRAS.

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation.

Chromosomal Localization:

12p12.1

Expression System:

E. coli

NCBI Accession Number:

NP_004976.2

Swiss Prot Accession Number:

P01116

DNA Source:

R999-X117-566

Immunogen:

Recombinant Full Length Protein

Vector Name:

pDest-566

Extinction Coefficient:

Buffers:


Expressed Sequence:

GGSGTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVID
GETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYR
EQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAK
TRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKCVIM

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

21552

Last Updated:

11/26/2019

Links

Characterization Data

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com