KRAS Proto-Oncogene, GTPase


Background

Catalog Number:

CPTC-KRAS4B-1

RRID:

AB_2722074

Target Antigen:

KRAS Proto-Oncogene, GTPase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/03/2019

Antigen Recognition(s):

Recombinant Full-length

Thematic Panel(s):

Ras Pathway

Purchase
Publications
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image Western blot of CPTC-KRAS4b-1 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins. Click image to enlarge

CPTC-KRAS4B-1 Cross Reactivity

Result: Positive

Western blot of CPTC-KRAS4b-1 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins.


  IP
Download This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-1 antibody. (1.4 MB)

CPTC-KRAS4B-1 IPMS

Result: Positive

This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-1 antibody.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot of CPTC-KRAS4b-1 antibody with full length KRAS4b recombinant protein. Click image to enlarge

CPTC-KRAS4B-1 Western blot

Result: Positive

Western blot of CPTC-KRAS4b-1 antibody with full length KRAS4b recombinant protein.


Background

Catalog Number:

CPTC-KRAS4B-2

RRID:

AB_2722075

Target Antigen:

KRAS Proto-Oncogene, GTPase

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

Thematic Panel(s):

Ras Pathway

Purchase
Publications
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image Western blot of CPTC-KRAS4b-2 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins. Click image to enlarge

CPTC-KRAS4B-2 Cross Reactivity

Result: Positive

Western blot of CPTC-KRAS4b-2 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins.


  IP
Download This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-2 antibody. (1.4 MB)

CPTC-KRAS4B-2 IPMS

Result: Positive

This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-2 antibody.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot of CPTC-KRAS4b-2 antibody with full length KRAS4b, recombinant protein. Click image to enlarge

CPTC-KRAS4B-2 Western blot

Result: Positive

Western blot of CPTC-KRAS4b-2 antibody with full length KRAS4b, recombinant protein.


Background

Catalog Number:

CPTC-KRAS4B-3

RRID:

AB_2722076

Target Antigen:

KRAS Proto-Oncogene, GTPase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

Thematic Panel(s):

Ras Pathway

Purchase
Publications
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins. Click image to enlarge

CPTC-KRAS4B-3 Cross Reactivity

Result: Positive

Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins.


  IP
Download This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-3 antibody. (1.3 MB)

CPTC-KRAS4B-3 IPMS

Result: Positive

This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-3 antibody.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein. Click image to enlarge

CPTC-KRAS4B-3 Western blot

Result: Positive

Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein. Click image to enlarge

CPTC-KRAS4B-3 Western blot

Result: Positive

Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein.


Background

Catalog Number:

CPTC-KRAS4B-4

RRID:

AB_2722077

Target Antigen:

KRAS Proto-Oncogene, GTPase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

Thematic Panel(s):

Ras Pathway

Purchase
Publications
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image Western blot of CPTC-KRAS4b-4 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins. Click image to enlarge

CPTC-KRAS4B-4 Cross Reactivity

Result: Positive

Western blot of CPTC-KRAS4b-4 antibody with full length KRAS4a,KRAS4b, H-RAS and N-RAS recombinant proteins.


  IP
Download This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-4 antibody. (Note that this antibody does not pull down KRAS4A antigen.) (1.3 MB)

CPTC-KRAS4B-4 IPMS

Result: Positive

This PDF shows the results of immuno-precipitation mass spectrometry (IPMS) assay of both KRAS4A and KRAS4B antigens using the CPTC-KRAS4B-4 antibody. (Note that this antibody does not pull down KRAS4A antigen.)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KRAS4B-4 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein. Click image to enlarge

CPTC-KRAS4B-4 Western blot

Result: Positive

Western blot of CPTC-KRAS4b-3 antibody with full length KRAS4b recombinant protein.


Background

NCI Identification Number:

00125

Antigen Name:

KRAS Proto-Oncogene, GTPase

CPTC Name:

CPTC-KRAS4B

Aliases:

Kirsten Rat Sarcoma Viral Oncogene Homolog; CFC2; KRAS1; KRAS Proto-Oncogene, GTPase; KRAS2; V-Ki-Ras2 Kirsten Rat Sarcoma 2 Viral Oncogene Homolog; GTPase KRas; C-Ki-Ras; K-Ras4B; K-Ras 2; RASK2; V-Ki-Ras2 Kirsten Rat Sarcoma Viral Oncogene Homolog; Kirsten Rat Sarcoma Viral Proto-Oncogene; Cellular Transforming Proto-Oncogene; Cellular C-Ki-Ras2 Proto-Oncogene; Transforming Protein P21; PR310 C-K-Ras Oncogene; C-Kirsten-Ras Protein; Proto-Oncogene GTPase; K-Ras P21 Protein; Oncogene KRAS2; EC 3.6.5.2; C-Ki-Ras2; ; C-K-RAS; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; C-K-Ras; KI-RAS; Ki-Ras; K-Ras; RALD; NS3; OES; NS

Function:

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal regionMutations in the RAS family of proteins are frequently observed across cancer types. The amino acid positions that account for the overwhelming majority of these mutations are G12, G13 and Q61. The different protein isoforms, despite their raw similarity, also behave very differently when expressed in non-native tissue types, likely due to differences in the C-terminal hyper-variable regions. Mis-regulation of isoform expression has been shown to be a driving event in cancer, as well as missense mutations at the three hotspots previously mentioned. While highly recurrent in cancer, attempts to target these RAS mutants with inhibitors have not been successful, and has not yet become common practice in the clinic. The prognostic implications for KRAS mutations vary between cancer types, but have been shown to be associated with poor outcome in colorectal cancer, non-small cell lung cancer, and others.KRAS (KRAS Proto-Oncogene, GTPase) is a Protein Coding gene. Diseases associated with KRAS include Oculoectodermal Syndrome and Schimmelpenning-Feuerstein-Mims Syndrome. Among its related pathways are Envelope proteins and their potential roles in EDMD physiopathology and MET promotes cell motility. Gene Ontology (GO) annotations related to this gene include GTP binding and protein-containing complex binding. An important paralog of this gene is HRAS.Ras proteins bind GDP/GTP and possess intrinsic GTPase activity (PubMed:20949621). Plays an important role in the regulation of cell proliferation (PubMed:23698361, PubMed:22711838). Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner (PubMed:24623306).

Chromosomal Localization:

12p12.1

Expression System:

E. coli

Accession Number:

NP_004976.2

UniProt Accession Number:

P01116

DNA Source:

R999-X117-566

Immunogen:

Recombinant Full Length Protein

Vector Name:

pDest-566

Extinction Coefficient:

Buffers:

Expressed Sequence:

GGSGTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVID
GETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYR
EQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAK
TRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKCVIM

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

21552

Last Updated:

07/06/2022

Links

Characterization Data

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com