Interleukin 18


Background

Catalog Number:

CPTC-IL18-1

RRID:

AB_1553714

Target Antigen:

Interleukin 18

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF describes the results of the evaluation of this antibody by the Human Protein Atlas (www.proteinatlas.org). (146.8 KB)

CPTC IL-18-1 HPA Evaluation

Result: Positive

This PDF describes the results of the evaluation of this antibody by the Human Protein Atlas (www.proteinatlas.org).


  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC IL-18-1 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer:1:1000 Click image to enlarge

CPTC IL-18-1 IHC NCI60

Result: Positive

Immunohistochemistry of CPTC IL-18-1 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer:1:1000


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC IL-18-1. Titer: 1:1000 Click image to enlarge

CPTC IL-18-1 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC IL-18-1. Titer: 1:1000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-IL18-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC IL-18-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC IL-18-1 Protein Array

Result: Positive

Protein Array in which CPTC IL-18-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-IL18-1 as primary Ab against Ag 10190 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-IL18-1 Western Blot

Result: Positive

Western Blot using CPTC-IL18-1 as primary Ab against Ag 10190 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-IL18-2

RRID:

AB_1553716

Target Antigen:

Interleukin 18

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (568.5 KB)

CPTC-IL18-2 evaluation by the Human Protein Atlas

Result: Positive

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).


  IHC NCI60
Click to enlarge image 
Immunohistochemistry of CPTC-IL18-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50 Click image to enlarge

CPTC-IL18-2 IHC NCI60

Result: Positive


Immunohistochemistry of CPTC-IL18-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-IL18-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-IL18-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-IL18-2 Protein Array

Result: Positive

Protein Array in which CPTC-IL18-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-IL18-2 as primary Ab against Ag 10190 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-IL18-2 Western Blot

Result: Positive

Western Blot using CPTC-IL18-2 as primary Ab against Ag 10190 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-IL18-3

RRID:

AB_2123661

Target Antigen:

Interleukin 18

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (95.9 KB)

CPTC-IL18-3

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-IL18-3 for NCI60  Cell Line Array at titer 1:3000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-IL18-3 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-IL18-3 for NCI60 Cell Line Array at titer 1:3000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


  IHC Tissue
Click to enlarge image Tissue Micro-Array (TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-IL18-3. Click image to enlarge

CPTC-IL18-3 IHC Tissue

Result: Positive

Tissue Micro-Array (TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-IL18-3.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-IL18-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-IL18-3 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-IL18-3 as primary Ab against Ag 10190 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-IL18-3 Western Blot

Result: Positive

Western Blot using CPTC-IL18-3 as primary Ab against Ag 10190 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10190

Antigen Name:

Interleukin 18

CPTC Name:

CPTC-IL18

Keywords:

IL-18; IG1F; IL-1g; IL1F4; MGC12320; Interferon gamma inducing factor

Function:

Interleukin-18 (IL-18) is a cytokine produced by macrophages and other cells that belongs to the IL-1 superfamily. IL-18 works together with IL-12 to induce cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon gamma or type II interferon that plays an important role in activating the macrophages or other cells. Apart from its physiological role, IL-18 is also able to induce severe inflammatory reactions, which suggests its role in certain inflammatory disorders. The protein encoded by this gene is a proinflammatory cytokine. This cytokine can induce the IFN-gamma production of T cells. The combination of this cytokine and IL12 has been shown to inhibit IL4 dependent IgE and IgG1 production, and enhance IgG2a production of B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.

Chromosomal Localization:

11q22.2 - q22.3

Expression System:

E. Coli

NCBI Accession Number:

NM_001562

UniProt Accession Number:

Q14116

DNA Source:

HIP:HsCD00000423

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

7575

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSV
IRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMA
VTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDN
KMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED

Native Sequence:

MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRN
LNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTI
SVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQ
FESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED

Calculated Isoelectric Point:

4.54

Molecular Weight:

22598

Last Updated:

09/01/2008

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10190 with molecular weight standards
Click image to enlarge

Ag 10190

PAGE of Ag 10190 with molecular weight standards

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com