Geminin


Background

Catalog Number:

CPTC-GMNN-1

Target Antigen:

Geminin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

07/12/2016

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-GMNN-1 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GMNN-1 Western blot

Western Blot using CPTC-GMNN-1 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GMNN-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-GMNN-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-GMNN-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-GMNN-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC HPA
Download CPTC-GMNN-1.pdf (109.2 KB)

CPTC-GMNN-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-GMNN-2

Target Antigen:

Geminin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

07/12/2016

Antigen Recognition(s):

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-GMNN-2 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GMNN-2 Western blot

Western Blot using CPTC-GMNN-2 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GMNN-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer  showing nuclear staining using Antibody CPTC-GMNN-2. Titer: 1:800 Click image to enlarge

CPTC-GMNN-2 IHC Tissue

Tissue Micro-Array(TMA) core of lung cancer showing nuclear staining using Antibody CPTC-GMNN-2. Titer: 1:800

  IHC HPA
Download CPTC-GMNN-2.pdf (98.1 KB)

CPTC-GMNN-2 Evaluation by

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-GMNN-3

Target Antigen:

Geminin

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

07/12/2016

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-GMNN-3 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GMNN-3 Western blot

Western Blot using CPTC-GMNN-3 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GMNN-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-GMNN-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-GMNN-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-GMNN-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC HPA
Download CPTC-GMNN-3.pdf (95.7 KB)

CPTC-GMNN-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

NCI Identification Number:

10987

Antigen Name:

Geminin

CPTC Name:

CPTC-GMNN

Keywords:

Gem; OTTHUMP00000039393; RP3-369A17.3; geminin

Function:

Inhibits DNA replication by preventing the incorporation of MCM complex into prereplication complex (pre-RC). It is degraded during the mitotic phase of the cell cycle. Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle.

Chromosomal Localization:

6p22.2

Expression System:

E. Coli

NCBI Accession Number:

BC005185.1

Swiss Prot Accession Number:

O75496

DNA Source:

OB : MHS1011-62496

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

10033

Buffers:

PBS

Expressed Sequence:

SNAMNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAG
LSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQ
YWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEH
VQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEG
TVSSSTDAKPCI

Native Sequence:

MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSK
RKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWK
EVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQY
MAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVS
SSTDAKPCI

Calculated Isoelectric Point:

4.93

Molecular Weight:

23.57

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click image to enlarge

CPTC-GMNN PAGE

PAGE of Ag 10987 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com