Geminin


Background

Catalog Number:

CPTC-GMNN-1

Target Antigen:

Geminin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (109.2 KB)

CPTC-GMNN-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-GMNN-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-GMNN-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GMNN-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array

CPTC-GMNN-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GMNN-1 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GMNN-1 Western blot

Result: Positive

Western Blot using CPTC-GMNN-1 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-GMNN-2

Target Antigen:

Geminin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (98.1 KB)

CPTC-GMNN-2 Evaluation by

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer  showing nuclear staining using Antibody CPTC-GMNN-2. Titer: 1:800 Click image to enlarge

CPTC-GMNN-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of lung cancer showing nuclear staining using Antibody CPTC-GMNN-2. Titer: 1:800


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GMNN-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GMNN-2 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GMNN-2 Western blot

Result: Positive

Western Blot using CPTC-GMNN-2 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-GMNN-3

Target Antigen:

Geminin

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (95.7 KB)

CPTC-GMNN-3 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-GMNN-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-GMNN-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GMNN-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array

CPTC-GMNN-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GMNN-3 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GMNN-3 Western blot

Result: Positive

Western Blot using CPTC-GMNN-3 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10987

Antigen Name:

Geminin

CPTC Name:

CPTC-GMNN

Keywords:

Gem; OTTHUMP00000039393; RP3-369A17.3; geminin

Function:

Inhibits DNA replication by preventing the incorporation of MCM complex into prereplication complex (pre-RC). It is degraded during the mitotic phase of the cell cycle. Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle.

Chromosomal Localization:

6p22.2

Expression System:

E. Coli

NCBI Accession Number:

BC005185.1

Swiss Prot Accession Number:

O75496

DNA Source:

OB : MHS1011-62496

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

10033

Buffers:

PBS

Expressed Sequence:

SNAMNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAG
LSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQ
YWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEH
VQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEG
TVSSSTDAKPCI

Native Sequence:

MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSK
RKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWK
EVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQY
MAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVS
SSTDAKPCI

Calculated Isoelectric Point:

4.93

Molecular Weight:

23.57

Last Updated:

11/14/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10987 (with molecular weight standards in lane 1)
Click image to enlarge

CPTC-GMNN PAGE

PAGE of Ag 10987 (with molecular weight standards in lane 1)

No SOPs available.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com