PRINT

Lactoylglutathione Lyase

Antibody: CPTC-GLO1-1
Background

Catalog Number:

CPTC-GLO1-1

RRID:

AB_1553719

Target Antigen:

Lactoylglutathione Lyase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

05/23/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for GLO1-1 Ab (615A3.1) using Biacore SPR method Click image to enlarge

CPTC-GLO1-1 SPR

Result: Positive

Kinetic titration data for GLO1-1 Ab (615A3.1) using Biacore SPR method


Characterization SOP Files

  CyTOF
Click to enlarge image Imaging mass cytometry on prostate cancer tissue core using CPTC-GLO1-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (colon, breast, ovarian, lung, and prostate). Click image to enlarge

CPTC-GLO1-1 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on prostate cancer tissue core using CPTC-GLO1-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (colon, breast, ovarian, lung, and prostate).


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (140.8 KB)

CPTC-GLO1-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-GLO1-1 for NCI60 Cell Line Array at titer Titer: 1:50 0=NEGATIVE 1=WEAK(red) 2=MODERATE(blue) 3=STRONG(green) Click image to enlarge

CPTC-GLO1-1 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-GLO1-1 for NCI60 Cell Line Array at titer Titer: 1:50
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:50 Human assay: U-2 OS fixed with PFA, dilution: 1:50 Human assay: U-251 MG fixed with PFA, dilution: 1:50 Click image to enlarge

CPTC-GLO1-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:50
Human assay: U-2 OS fixed with PFA, dilution: 1:50
Human assay: U-251 MG fixed with PFA, dilution: 1:50


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GLO1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-GLO1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GLO1-1 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-GLO1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:250. Click image to enlarge

CPTC-GLO1-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:250.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GLO1-1 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GLO1-1 Western Blot

Result: Positive

Western Blot using CPTC-GLO1-1 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-GLO1-1 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GLO1-1 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-GLO1-1 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-GLO1-2
Background

Catalog Number:

CPTC-GLO1-2

RRID:

AB_1553721

Target Antigen:

Lactoylglutathione Lyase

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (150.6 KB)

CPTC-GLO1-2 evaluation by the Human Protein Atlas

Result: Positive

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).


Characterization SOP Files

  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-GLO1-2 for NCI60 Cell Line Array. Data scored as: 0=NEGATIVE 1=WEAK (red) 2=MODERATE (blue) 3=STRONG (green) TITER: 1:2500 Click image to enlarge

CPTC-GLO1-2 IHC NCI60

Result: Positive

Immunohistochemistry of CPTC-GLO1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
TITER: 1:2500


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GLO1-2. Titer: 1:2500 Click image to enlarge

CPTC-GLO1-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GLO1-2. Titer: 1:2500


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GLO1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-GLO1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GLO1-2 NCI60 Protein Array

Result: Positive

Protein Array in which CPTC-GLO1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GLO1-2 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GLO1-2 Western Blot

Result: Positive

Western Blot using CPTC-GLO1-2 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-GLO1-3
Background

Catalog Number:

CPTC-GLO1-3

RRID:

AB_2109905

Target Antigen:

Lactoylglutathione Lyase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

05/23/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for GLO1-3 Ab (615A28.1) using Biacore SPR method Click image to enlarge

CPTC-GLO1-3 SPR

Result: Positive

Kinetic titration data for GLO1-3 Ab (615A28.1) using Biacore SPR method


Characterization SOP Files

  CyTOF
Click to enlarge image Imaging mass cytometry on normal prostate tissue core using CPTC-GLO1-3 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (colon, breast, ovarian, lung, and prostate). Click image to enlarge

CPTC-GLO1-3 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on normal prostate tissue core using CPTC-GLO1-3 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (colon, breast, ovarian, lung, and prostate).


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (129.0 KB)

CPTC-GLO1-3 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-GLO1-3 for NCI60 Cell Line Array at titer 1:100 0=NEGATIVE 1=WEAK(red) 2=MODERATE(blue) 3=STRONG(green) Click image to enlarge

CPTC-GLO1-3 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-GLO1-3 for NCI60 Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:200 Human assay: U-2 OS fixed with PFA, dilution: 1:200 Human assay: U-251 MG fixed with PFA, dilution: 1:200 Click image to enlarge

CPTC-GLO1-3 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:200
Human assay: U-2 OS fixed with PFA, dilution: 1:200
Human assay: U-251 MG fixed with PFA, dilution: 1:200


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GLO1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GLO1-3 Protein Array

Result: Positive

Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:250. Click image to enlarge

CPTC-GLO1-3 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:250.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GLO1-3 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GLO1-3 Western Blot

Result: Positive

Western Blot using CPTC-GLO1-3 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antigen: Lactoylglutathione Lyase
Background

NCI Identification Number:

10246

Antigen Name:

Lactoylglutathione Lyase

CPTC Name:

CPTC-GLO1

Aliases:

GLO1; glyoxalase 1; Aldoketomutase; EC 4.4.1.5; GLOD1; GLY1; Methylglyoxalase; GLX1; ketone-aldehyde mutase; S-D-lactoyl glutathione methyl glyoxal lyase; OTTHUMP00000016339

Function:

The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.

Chromosomal Localization:

6p21.3 p21.1

Expression System:

E. Coli

Accession Number:

NM_006708

UniProt Accession Number:

Q04760

DNA Source:

HIP:HsCD00000982

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

25565

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLD
FYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKA
TLELTHNWGTEDDATQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGV
KFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM

Native Sequence:

MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYT
RVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLE
LTHNWGTEDDATQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFV
KKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM

Calculated Isoelectric Point:

5.24

Molecular Weight:

20992

Last Updated:

08/22/2020

Links

Characterization Data

Gel

Click to enlarge image SDS-PAGE of CPTC-GLO1 with molecular weight markers (in Lane 1)
Click image to enlarge

CPTC-GLO1 (Ag 10246) PAGE

SDS-PAGE of CPTC-GLO1 with molecular weight markers (in Lane 1)

[top]

SOPs

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]