Lactoylglutathione lyase


Background

Catalog Number:

CPTC-GLO1-1

Target Antigen:

Lactoylglutathione lyase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for GLO1-1 Ab (615A3.1) using Biacore SPR method Click image to enlarge

CPTC-GLO1-1 SPR

Result: Positive

Kinetic titration data for GLO1-1 Ab (615A3.1) using Biacore SPR method


  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-GLO1-1 for NCI60  Cell Line Array at titer Titer: 1:50
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-GLO1-1 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-GLO1-1 for NCI60 Cell Line Array at titer Titer: 1:50
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GLO1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-GLO1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GLO1-1 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-GLO1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Cell Lysate
Click to enlarge image Western Blot using CPTC-GLO1-1 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GLO1-1 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-GLO1-1 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GLO1-1 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GLO1-1 Western Blot

Result: Positive

Western Blot using CPTC-GLO1-1 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-GLO1-2

Target Antigen:

Lactoylglutathione lyase

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (150.6 KB)

CPTC-GLO1-2 evaluation by the Human Protein Atlas

Result: Positive

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).


  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-GLO1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
TITER: 1:2500 Click image to enlarge

CPTC-GLO1-2 IHC NCI60

Result: Positive

Immunohistochemistry of CPTC-GLO1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
TITER: 1:2500


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GLO1-2. Titer: 1:2500 Click image to enlarge

CPTC-GLO1-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GLO1-2. Titer: 1:2500


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GLO1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-GLO1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GLO1-2 NCI60 Protein Array

Result: Positive

Protein Array in which CPTC-GLO1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GLO1-2 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GLO1-2 Western Blot

Result: Positive

Western Blot using CPTC-GLO1-2 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-GLO1-3

Target Antigen:

Lactoylglutathione lyase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for GLO1-3 Ab (615A28.1) using Biacore SPR method Click image to enlarge

CPTC-GLO1-3 SPR

Result: Positive

Kinetic titration data for GLO1-3 Ab (615A28.1) using Biacore SPR method


  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-GLO1-3 for NCI60  Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-GLO1-3 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-GLO1-3 for NCI60 Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GLO1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GLO1-3 Protein Array

Result: Positive

Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GLO1-3 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GLO1-3 Western Blot

Result: Positive

Western Blot using CPTC-GLO1-3 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10246

Antigen Name:

Lactoylglutathione lyase

CPTC Name:

CPTC-GLO1

Keywords:

GLO1; glyoxalase 1; Aldoketomutase; EC 4.4.1.5; GLOD1; GLY1; Methylglyoxalase; GLX1; ketone-aldehyde mutase; S-D-lactoyl glutathione methyl glyoxal lyase; OTTHUMP00000016339

Function:

The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.

Chromosomal Localization:

6p21.3 p21.1

Expression System:

E. Coli

NCBI Accession Number:

NM_006708

Swiss Prot Accession Number:

Q04760

DNA Source:

HIP:HsCD00000982

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

25565

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLD
FYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKA
TLELTHNWGTEDDATQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGV
KFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM

Native Sequence:

MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYT
RVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLE
LTHNWGTEDDATQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFV
KKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM

Calculated Isoelectric Point:

5.24

Molecular Weight:

20992

Last Updated:

10/24/2019

Links

Characterization Data

Gel

Click to enlarge image SDS-PAGE of CPTC-GLO1 with molecular weight markers (in Lane 1)
Click image to enlarge

CPTC-GLO1 (Ag 10246) PAGE

SDS-PAGE of CPTC-GLO1 with molecular weight markers (in Lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com