Lactoylglutathione lyase


Background

Catalog Number:

CPTC-GLO1-1

Target Antigen:

Lactoylglutathione lyase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

12/15/2011

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GLO1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-GLO1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GLO1-1 NCI 60 Protein Array

Protein Array in which CPTC-GLO1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  Western Blot
Click to enlarge image Western Blot using CPTC-GLO1-1 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GLO1-1 Western Blot

Western Blot using CPTC-GLO1-1 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-GLO1-1 for NCI60  Cell Line Array at titer Titer: 1:50
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-GLO1-1 IHC NCI60

Immuno-histochemistry of CPTC-GLO1-1 for NCI60 Cell Line Array at titer Titer: 1:50
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for GLO1-1 Ab (615A3.1) using Biacore SPR method Click image to enlarge

CPTC-GLO1-1 SPR

Kinetic titration data for GLO1-1 Ab (615A3.1) using Biacore SPR method

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-GLO1-1 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GLO1-1 Cell Lysate Western blot

Western Blot using CPTC-GLO1-1 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Background

Catalog Number:

CPTC-GLO1-2

Target Antigen:

Lactoylglutathione lyase

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

12/15/2011

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GLO1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-GLO1-2 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GLO1-2 Western Blot

Western Blot using CPTC-GLO1-2 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-GLO1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GLO1-2 NCI60 Protein Array

Protein Array in which CPTC-GLO1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (150.6 KB)

CPTC-GLO1-2 evaluation by the Human Protein Atlas

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).

  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-GLO1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
TITER: 1:2500 Click image to enlarge

CPTC-GLO1-2 IHC NCI60

Immunohistochemistry of CPTC-GLO1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
TITER: 1:2500

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GLO1-2. Titer: 1:2500 Click image to enlarge

CPTC-GLO1-2 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GLO1-2. Titer: 1:2500

Background

Catalog Number:

CPTC-GLO1-3

Target Antigen:

Lactoylglutathione lyase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

12/15/2011

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GLO1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-GLO1-3 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GLO1-3 Western Blot

Western Blot using CPTC-GLO1-3 as primary Ab against GLO1 (Ag 10246) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-GLO1-3 for NCI60  Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-GLO1-3 IHC NCI60

Immuno-histochemistry of CPTC-GLO1-3 for NCI60 Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GLO1-3 Protein Array

Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for GLO1-3 Ab (615A28.1) using Biacore SPR method Click image to enlarge

CPTC-GLO1-3 SPR

Kinetic titration data for GLO1-3 Ab (615A28.1) using Biacore SPR method

Background

NCI Identification Number:

10246

Antigen Name:

Lactoylglutathione lyase

CPTC Name:

CPTC-GLO1

Keywords:

GLO1; glyoxalase 1; Aldoketomutase; EC 4.4.1.5; GLOD1; GLY1; Methylglyoxalase; GLX1; ketone-aldehyde mutase; S-D-lactoyl glutathione methyl glyoxal lyase; OTTHUMP00000016339

Function:

The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.

Chromosomal Localization:

6p21.3 p21.1

Expression System:

E. Coli

NCBI Accession Number:

NM_006708

Swiss Prot Accession Number:

Q04760

DNA Source:

HIP:HsCD00000982

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

25565

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLD
FYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKA
TLELTHNWGTEDDATQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGV
KFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM

Native Sequence:

MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYT
RVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLE
LTHNWGTEDDATQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFV
KKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM

Calculated Isoelectric Point:

5.24

Molecular Weight:

20992

Last Updated:

04/12/2013

Links

Characterization Data

Gel

Click to enlarge image SDS-PAGE of CPTC-GLO1 with molecular weight markers (in Lane 1)
Click image to enlarge

CPTC-GLO1 (Ag 10246) PAGE

SDS-PAGE of CPTC-GLO1 with molecular weight markers (in Lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com