Glutamate-Cysteine Ligase Regulatory Subunit


Background

Catalog Number:

CPTC-GCLM-1

Target Antigen:

Glutamate-Cysteine Ligase Regulatory Subunit

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

12/15/2011

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GCLM-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot Using CPTC-GCLM-1 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-GCLM-1 Western Blot

Western Blot Using CPTC-GCLM-1 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

Background

Catalog Number:

CPTC-GCLM-2

Target Antigen:

Glutamate-Cysteine Ligase Regulatory Subunit

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

12/15/2011

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GCLM -2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot Using CPTC-GCLM-2 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-GCLM-2 Western Blot

Western Blot Using CPTC-GCLM-2 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-GCLM-2  is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GCLM-2 Protein Array

Protein Array in which CPTC-GCLM-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-GCLM-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:100 Click image to enlarge

CPTC-GCLM-2 IHC NCI60

Immunohistochemistry of CPTC-GCLM-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:100

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GCLM-2. Titer: 1:100 Click image to enlarge

CPTC-GCLM-2 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GCLM-2. Titer: 1:100

Background

Catalog Number:

CPTC-GCLM-3

Target Antigen:

Glutamate-Cysteine Ligase Regulatory Subunit

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/28/2013

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GCLM -3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-GCLM-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Click image to enlarge

CPTC-GCLM-3 NCI60 Protein Array

Protein Array in which CPTC-GCLM-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-GCLM-3 for NCI60  Cell Line Array with titer of 1:5000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-GCLM-3 IHC NCI60

Immuno-histochemistry of CPTC-GCLM-3 for NCI60 Cell Line Array with titer of 1:5000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

  IHC Tissue

CPTC-GCLM-3 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GCLM-3. Titer: 1:5000

  Western Blot
Click to enlarge image Western Blot Using CPTC-GCLM-3 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-GCLM-3 Western blot

Western Blot Using CPTC-GCLM-3 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

Background

NCI Identification Number:

10466

Antigen Name:

Glutamate-Cysteine Ligase Regulatory Subunit

CPTC Name:

CPTC-GCLM

Keywords:

GCLM; GLCLR; OTTHUMP00000012299

Function:

Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.

Chromosomal Localization:

1p22.1

Expression System:

E. Coli

NCBI Accession Number:

BC041809

Swiss Prot Accession Number:

P48507

DNA Source:

HIP:HsCD00005436

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

39148

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCI
QKTLNEWSSQINPDLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFI
VESNSSSSTRSAVDMACSVLGVAQLDSVIIASPPIEDGVNLSLEHLQPYW
EELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMP
PDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWL
LRYSVIVKSRGIIKSKGYILQAKRRGS

Native Sequence:

MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKT
LNEWSSQINPDLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVES
NSSSSTRSAVDMACSVLGVAQLDSVIIASPPIEDGVNLSLEHLQPYWEEL
ENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDL
TAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRY
SVIVKSRGIIKSKGYILQAKRRGS

Calculated Isoelectric Point:

5.69

Molecular Weight:

30999

Last Updated:

04/09/2013

Links

Characterization Data

Gel

Click to enlarge image PAGE of GCLM (rAg 10466) with molecular weight standards in lane 1.
Click image to enlarge

CPTC-GCLM (rAg 10466) PAGE

PAGE of GCLM (rAg 10466) with molecular weight standards in lane 1.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com