Glutamate-Cysteine Ligase Regulatory Subunit


Background

Catalog Number:

CPTC-GCLM-1

RRID:

AB_1553692

Target Antigen:

Glutamate-Cysteine Ligase Regulatory Subunit

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (163.9 KB)

CPTC-GCLM-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:20
Human assay: U-2 OS fixed with PFA, dilution: 1:20
Human assay: U-251 MG fixed with PFA, dilution: 1:20 Click image to enlarge

CPTC-GCLM-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:20
Human assay: U-2 OS fixed with PFA, dilution: 1:20
Human assay: U-251 MG fixed with PFA, dilution: 1:20


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GCLM-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot Using CPTC-GCLM-1 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-GCLM-1 Western Blot

Result: Positive

Western Blot Using CPTC-GCLM-1 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).


Background

Catalog Number:

CPTC-GCLM-2

RRID:

AB_1553694

Target Antigen:

Glutamate-Cysteine Ligase Regulatory Subunit

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

08/24/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (116.2 KB)

CPTC-GCLM-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-GCLM-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:100 Click image to enlarge

CPTC-GCLM-2 IHC NCI60

Result: Positive

Immunohistochemistry of CPTC-GCLM-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:100


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GCLM-2. Titer: 1:100 Click image to enlarge

CPTC-GCLM-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GCLM-2. Titer: 1:100


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GCLM -2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-GCLM-2  is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GCLM-2 Protein Array

Result: Positive

Protein Array in which CPTC-GCLM-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot Using CPTC-GCLM-2 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-GCLM-2 Western Blot

Result: Positive

Western Blot Using CPTC-GCLM-2 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).


Background

Catalog Number:

CPTC-GCLM-3

RRID:

AB_2107843

Target Antigen:

Glutamate-Cysteine Ligase Regulatory Subunit

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

08/24/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (109.5 KB)

CPTC-GCLM-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-GCLM-3 for NCI60  Cell Line Array with titer of 1:5000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-GCLM-3 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-GCLM-3 for NCI60 Cell Line Array with titer of 1:5000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


  IHC Tissue

CPTC-GCLM-3 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GCLM-3. Titer: 1:5000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GCLM -3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-GCLM-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Click image to enlarge

CPTC-GCLM-3 NCI60 Protein Array

Result: Positive

Protein Array in which CPTC-GCLM-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot Using CPTC-GCLM-3 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-GCLM-3 Western blot

Result: Positive

Western Blot Using CPTC-GCLM-3 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).


Background

NCI Identification Number:

10466

Antigen Name:

Glutamate-Cysteine Ligase Regulatory Subunit

CPTC Name:

CPTC-GCLM

Keywords:

GCLM; GLCLR; OTTHUMP00000012299

Function:

Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.

Chromosomal Localization:

1p22.1

Expression System:

E. Coli

NCBI Accession Number:

BC041809

UniProt Accession Number:

P48507

DNA Source:

HIP:HsCD00005436

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

39148

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCI
QKTLNEWSSQINPDLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFI
VESNSSSSTRSAVDMACSVLGVAQLDSVIIASPPIEDGVNLSLEHLQPYW
EELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMP
PDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWL
LRYSVIVKSRGIIKSKGYILQAKRRGS

Native Sequence:

MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKT
LNEWSSQINPDLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVES
NSSSSTRSAVDMACSVLGVAQLDSVIIASPPIEDGVNLSLEHLQPYWEEL
ENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDL
TAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRY
SVIVKSRGIIKSKGYILQAKRRGS

Calculated Isoelectric Point:

5.69

Molecular Weight:

30999

Last Updated:

09/01/2008

Links

Characterization Data

Gel

Click to enlarge image PAGE of GCLM (rAg 10466) with molecular weight standards in lane 1.
Click image to enlarge

CPTC-GCLM (rAg 10466) PAGE

PAGE of GCLM (rAg 10466) with molecular weight standards in lane 1.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com