Fas (TNFRSF6) associated factor 1


Background

Catalog Number:

CPTC-FAF1-1

Target Antigen:

Fas (TNFRSF6) associated factor 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-FAF1-1 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-FAF1-1 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-FAF1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-FAF1-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-FAF1-1 as primary Ab against FAF1 (rAg 10820) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-FAF1-1 Western blot

Result: Positive

Western Blot using CPTC-FAF1-1 as primary Ab against FAF1 (rAg 10820) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-FAF1-2

Target Antigen:

Fas (TNFRSF6) associated factor 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer  showing cytoplasmic staining using Antibody CPTC-FAF1-2. Titer: 1:100 Click image to enlarge

CPTC-FAF1-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-FAF1-2. Titer: 1:100


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-FAF1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-FAF1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-FAF1-2 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-FAF1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-FAF1-2 as primary Ab against FAF1 (rAg 10820) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-FAF1-2 Western blot

Result: Positive

Western Blot using CPTC-FAF1-2 as primary Ab against FAF1 (rAg 10820) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-FAF1-3

Target Antigen:

Fas (TNFRSF6) associated factor 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-FAF1-3 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-FAF1-3 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-FAF1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-FAF1-3 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-FAF1-3 as primary Ab against FAF1 (rAg 10820) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-FAF1-3 Western blot

Result: Positive

Western Blot using CPTC-FAF1-3 as primary Ab against FAF1 (rAg 10820) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10820

Antigen Name:

Fas (TNFRSF6) associated factor 1

CPTC Name:

CPTC-FAF1

Keywords:

CGI-03; FLJ37524; HFAF1s; UBXD12; UBXN3A; hFAF1

Function:

Interaction of Fas ligand (TNFSF6) with the FAS antigen (TNFRSF6) mediates programmed cell death, also called apoptosis, in a number of organ systems. The protein encoded by this gene binds to FAS antigen and can initiate apoptosis or enhance apoptosis initiated through FAS antigen. Initiation of apoptosis by the protein encoded by this gene requires a ubiquitin-like domain but not the FAS-binding domain.

Potentiates but cannot initiate FAS-induced apoptosis.

Chromosomal Localization:

1p33

Expression System:

E. Coli

NCBI Accession Number:

BC004970.1

Swiss Prot Accession Number:

Q9UNN5

DNA Source:

HIP : HsCD00041927

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

56630

Buffers:

PBS

Expressed Sequence:

SNAMASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQ
ENGILQSEYGGETIPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQ
PRMLDFRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKT
GDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLI
ITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDD
SMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDVHMVSDSDGDDFE
DATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGD
CHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCA
ESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQ
FPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQQQEDIKD
EDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQE
EEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQ
IVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLE
AKE

Native Sequence:

MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENG
ILQSEYGGETIPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRM
LDFRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDV
EDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITH
REVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMC
LAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDVHMVSDSDGDDFEDAT
EFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHP
VFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESI
VSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPL
FLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQQQEDIKDEDE
REARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEER
EAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVF
DFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE

Calculated Isoelectric Point:

4.81

Molecular Weight:

73.95

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of FAF1 (rAg 10820) with molecular weight standards in lane 1
Click image to enlarge

CPTC-FAF1 SDS PAGE

PAGE of FAF1 (rAg 10820) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com