Estrogen Receptor Binding Site Associated, Antigen 9


Background

Catalog Number:

CPTC-EBAG9-1

Target Antigen:

Estrogen Receptor Binding Site Associated, Antigen 9

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

06/13/2017

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-EBAG9-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-EBAG9-1 as primary Ab against EBAG9 (rAg 10772) in lane 3. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 2). Click image to enlarge

CPTC-EBAG9-1 Western blot

Western Blot using CPTC-EBAG9-1 as primary Ab against EBAG9 (rAg 10772) in lane 3. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 2).

  NCI 60 Protein Array

CPTC-EBAG9-1NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-EBAG9-1. Titer: 1:4000 Click image to enlarge

CPTC-EBAG9-1 IHC Tissue

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-EBAG9-1. Titer: 1:4000

Background

Catalog Number:

CPTC-EBAG9-2

Target Antigen:

Estrogen Receptor Binding Site Associated, Antigen 9

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

04/29/2014

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-EBAG9-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-EBAG9-2 as primary Ab against EBAG9 (rAg 10772) in lane 3. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 2). Click image to enlarge

CPTC-EBAG9-2 Western blot

Western Blot using CPTC-EBAG9-2 as primary Ab against EBAG9 (rAg 10772) in lane 3. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 2).

Background

Catalog Number:

CPTC-EBAG9-3

Target Antigen:

Estrogen Receptor Binding Site Associated, Antigen 9

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

04/02/2014

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-EBAG9-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-EBAG9-3 as primary Ab against EBAG9 (rAg 10772) in lane 3. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 2). Click image to enlarge

CPTC-EBAG9-3 Western blot

Western Blot using CPTC-EBAG9-3 as primary Ab against EBAG9 (rAg 10772) in lane 3. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 2).

  NCI 60 Protein Array

CPTC-EBAG9-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC Tissue

CPTC-EBAG9-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC NCI60

CPTC-EBAG9-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

NCI Identification Number:

10772

Antigen Name:

Estrogen Receptor Binding Site Associated, Antigen 9

CPTC Name:

CPTC-EBAG9

Keywords:

EB9; PDAF; RCAS1

Function:

This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor which binds to the estrogen-responsive element (ERE) found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Two transcript variants differing in the 5' UTR, but encoding the same protein, have been identified for this gene.

May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.

Chromosomal Localization:

8q23

Expression System:

E. Coli

NCBI Accession Number:

BC017729.1

Swiss Prot Accession Number:

O00559

DNA Source:

HIP : HsCD00040328

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

30480

Buffers:

PBS

Expressed Sequence:

SNAGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGG
NGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKRPLNFGIPDGSTGF
SSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQK
LADREKRAAEQQRKKMEKEAQRMKKEQNKIGVKLS

Native Sequence:

MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSS
VPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTP
TIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLD
TWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRL
MKKEQNKIGVKLS

Calculated Isoelectric Point:

5.06

Molecular Weight:

20.95

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image PAGE of EBAG9 (rAg 10772) with molecular weight standards (lane 1)
Click image to enlarge

CPTC-EBAG9 PAGE

PAGE of EBAG9 (rAg 10772) with molecular weight standards (lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com