Deleted in liver cancer 1


Background

Catalog Number:

CPTC-DLC1-1

Target Antigen:

Deleted in liver cancer 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

07/23/2015

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-DLC1-1 as primary Ab against DLC1 (rAg 00016) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-DLC1-1 Western blot

Western Blot using CPTC-DLC1-1 as primary Ab against DLC1 (rAg 00016) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-DLC1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-DLC1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-DLC1-2

Target Antigen:

Deleted in liver cancer 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

07/23/2015

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-DLC1-2 as primary Ab against DLC1 (rAg 00016) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-DLC1-2 Western blot

Western Blot using CPTC-DLC1-2 as primary Ab against DLC1 (rAg 00016) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-DLC1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-DLC1-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-DLC1-3

Target Antigen:

Deleted in liver cancer 1

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

03/05/2015

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-DLC1-3 as primary Ab against DLC1 (rAg 00016) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-DLC1-3 Western blot

Western Blot using CPTC-DLC1-3 as primary Ab against DLC1 (rAg 00016) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-DLC1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-DLC1-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

NCI Identification Number:

00016

Antigen Name:

Deleted in liver cancer 1

CPTC Name:

CPTC-DLC1

Keywords:

Deleted In Liver Cancer 1 Variant 2; ARHGAP7; STARD12; HP; P122-RhoGAP; DLC-1; Deleted In Liver Cancer 1 Protein; Rho-Type GTPase-Activating Protein 7; START Domain-Containing Protein 12; Rho GTPase-Activating Protein 7; StAR-Related Lipid Transfer (START) Domain Containing 12; KIAA1723; StARD12; HP Protein; StAR-Related Lipid Transfer Protein 12

Function:

This gene encodes a GTPase-activating protein (GAP) that is a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins. GAP family proteins participate in signaling pathways that regulate cell processes involved in cytoskeletal changes. This gene functions as a tumor suppressor gene in a number of common cancers, including prostate, lung, colorectal, and breast cancers. Multiple transcript variants due to alternative promoters and alternative splicing have been found for this gene.

Functions as a GTPase-activating protein for the small GTPases RHOA, RHOB, RHOC and CDC42, terminating their downstream signaling. This induces morphological changes and detachment through cytoskeletal reorganization, playing a critical role in biological processes such as cell migration and proliferation. Also functions in vivo as an activator of the phospholipase PLCD1. Active DLC1 increases cell migration velocity but reduces directionality

Chromosomal Localization:

8p22

Expression System:

E. coli

NCBI Accession Number:

NM_006094

Swiss Prot Accession Number:

Q96QB1

DNA Source:

Mammalian Gene Collection

Immunogen:

Recombinant Full Length Protein

Vector Name:

pET28-MHL

Extinction Coefficient:

Buffers:

PBS, pH 7.4

Expressed Sequence:

mhhhhhhssgrenlyfqgSVFGVPLTVNVQRTGQPLPQSIQQAMRYLRNH
CLDQVGLFRKSGVKSRIQALRQMNEGAIDCVNYEGQSAYDVADMLKQYFR
DLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAIMLLPDENREVLQTLL
YFLSDVTAAVKENQMTPTNLAVCLAPSLFHLNTLKRENSSPRVMQRKQSL
GKPDQKDLNENLAATQGLAHMIAECKKL

Native Sequence:

Calculated Isoelectric Point:

9.1

Molecular Weight:

26004

Last Updated:

06/11/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click image to enlarge

CPTC-DLC1 PAGE

PAGE of DLC1 (rAg 00016) with molecular weight standards in lane 1.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com