Catalog Number:
CPTC-DHDDS-1
Target Antigen:
Dehydrodolichyl Diphosphate Synthase Subunit
Isotype:
IgG1
Species:
Mouse Monoclonal Antibody
Last Updated:
03/21/2025
Antigen Recognition(s):
Recombinant Full-length, Endogenous
Result: No Binding
The affinity and binding kinetics of CPTC-DHDDS-1 antibody and full length DHDDS protein were measured using biolayer interferometry. Antibody was covalently immobilized onto AR2G biosensors using standard amine coupling. DHDDS protein at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. Buffer only and biosensors immobilized without antibody were used as references for background subtraction. No binding was observed.
Result: No Binding
Affinity and binding kinetics of CPTC-DHDDS-1 and full length DHDDS protein were measured using surface plasmon resonance. CPTC-DHDDS-1 antibody was amine coupled onto a Series S CM5 biosensor chip. DHDDS protein at, 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. No binding was observed.
Catalog Number:
CPTC-DHDDS-2
Target Antigen:
Dehydrodolichyl Diphosphate Synthase Subunit
Isotype:
IgG1
Species:
Mouse Monoclonal Antibody
Last Updated:
03/21/2025
Antigen Recognition(s):
Recombinant Full-length, Endogenous
Result: No Binding
The affinity and binding kinetics of CPTC-DHDDS-2 antibody and full length DHDDS protein were measured using biolayer interferometry. Antibody was covalently immobilized onto AR2G biosensors using standard amine coupling. DHDDS protein at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. Buffer only and biosensors immobilized without antibody were used as references for background subtraction. No binding was observed.
Result: No Binding
Affinity and binding kinetics of CPTC-DHDDS-2 and full length DHDDS protein were measured using surface plasmon resonance. CPTC-DHDDS-2 antibody was amine coupled onto a Series S CM5 biosensor chip. DHDDS protein at, 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. No binding was observed.
Catalog Number:
CPTC-DHDDS-3
Target Antigen:
Dehydrodolichyl Diphosphate Synthase Subunit
Isotype:
IgG1
Species:
Mouse Monoclonal Antibody
Last Updated:
03/21/2025
Antigen Recognition(s):
Recombinant Full-length
Result: No Binding
The affinity and binding kinetics of CPTC-DHDDS-3 antibody and full length DHDDS protein were measured using biolayer interferometry. Antibody was covalently immobilized onto AR2G biosensors using standard amine coupling. DHDDS protein at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. Buffer only and biosensors immobilized without antibody were used as references for background subtraction. No binding was observed.
Result: No Binding
Affinity and binding kinetics of CPTC-DHDDS-3 and full length DHDDS protein were measured using surface plasmon resonance. CPTC-DHDDS-3 antibody was amine coupled onto a Series S CM5 biosensor chip. DHDDS protein at, 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, and 0.25 nM, was used as analyte. No binding was observed.
NCI Identification Number:
00514
Antigen Name:
Dehydrodolichyl Diphosphate Synthase Subunit
CPTC Name:
CPTC-DHDDS
Aliases:
Dehydrodolichyl Diphosphate Synthase Subunit; HDS; RP59; HCIT; DS; Dehydrodolichyl Diphosphate Synthase Complex Subunit DHDDS; Cis-Prenyltransferase Subunit HCIT; Epididymis Tissue Protein Li 189m; Cis-Isoprenyltransferase; Cis-IPTase; FLJ13102; CIT; Dehydrodolichyl Diphosphate Syntase Complex Subunit DHDDS; Dehydrodolichyl Diphosphate Synthase; Cis-Prenyl Transferase; Dedol-PP Synthase; EC 2.5.1.87; DEDSM; CPT
Function:
The protein encoded by this gene catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins. Mutations in this gene are associated with retinitis pigmentosa type 59. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. DHDDS (Dehydrodolichyl Diphosphate Synthase Subunit) is a Protein Coding gene. Diseases associated with DHDDS include Retinitis Pigmentosa 59 and Developmental Delay And Seizures With Or Without Movement Abnormalities. Among its related pathways are Synthesis of substrates in N-glycan biosythesis and Metabolism of proteins. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring alkyl or aryl (other than methyl) groups.With NUS1, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Both subunits contribute to enzymatic activity, i.e. condensation of multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol phosphate which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER) (PubMed:25066056, PubMed:28842490, PubMed:32817466). Synthesizes long-chain polyprenols, mostly of C95 and C100 chain length (PubMed:32817466). Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol (PubMed:21572394).
Chromosomal Localization:
1p36.11
Expression System:
E.coli
Accession Number:
NP_995583.1
UniProt Accession Number:
Q86SQ9
DNA Source:
N/A
Immunogen:
Recombinant Full Length Protein
Vector Name:
N/A
Extinction Coefficient:
Buffers:
Expressed Sequence:
MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEG
HSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQK
FSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFL
NVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHP
DILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMN
HSVLQ-KARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRL
HKLSARREERVQGFLQALELKRADWLARLGTASA
Native Sequence:
Calculated Isoelectric Point:
Molecular Weight:
38000
Last Updated:
03/22/2022
No SOPs available.
Get it for free at Adobe.com