Cystatin B


Background

Catalog Number:

CPTC-CSTB-1

Target Antigen:

Cystatin B

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/11/2014

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CSTB-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-CSTB-1 as primary Ab against rAg 10098 (CSTB) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-CSTB-1 Western blot

Western Blot using CPTC-CSTB-1 as primary Ab against rAg 10098 (CSTB) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (88.7 KB)

CPTC-CSTB-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-CSTB-2

Target Antigen:

Cystatin B

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/11/2014

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CSTB-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-CSTB-2 as primary Ab against rAg 10098 (CSTB) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-CSTB-2 Western blot

Western Blot using CPTC-CSTB-2 as primary Ab against rAg 10098 (CSTB) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (86.7 KB)

CPTC-CSTB-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-CSTB-3

Target Antigen:

Cystatin B

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/11/2014

Antigen Recognition(s):

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CSTB-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-CSTB-3 as primary Ab against rAg 10098 (CSTB) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-CSTB-3 Western blot

Western Blot using CPTC-CSTB-3 as primary Ab against rAg 10098 (CSTB) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (99.5 KB)

CPTC-CSTB-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

NCI Identification Number:

10098

Antigen Name:

Cystatin B

CPTC Name:

CPTC-CSTB

Keywords:

CPI-B; CST6; EPM1; PME; STFB; Stefin-B

Function:

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins L, H and B. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy

This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B

Chromosomal Localization:

21q22.3

Expression System:

E. Coli

NCBI Accession Number:

BC010532

Swiss Prot Accession Number:

P04080

DNA Source:

HIP : HsCD00002240

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

4470

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQV
VAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTY
F

Native Sequence:

MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAG
TNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Calculated Isoelectric Point:

6.94

Molecular Weight:

11412

Last Updated:

02/26/2013

Links

Characterization Data

Gel

Click to enlarge image PAGE of CSTB (Ag 10098) with molecular weight standards in lane 1
Click image to enlarge

CPTC-CSTB SDS-PAGE

PAGE of CSTB (Ag 10098) with molecular weight standards in lane 1

No SOPs available.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com