Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)


Background

Catalog Number:

CPTC-CHP2-1

Target Antigen:

Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

07/03/2014

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CHP2-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-CHP2-1 as primary Ab against CHP2 (rAg 10965) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CHP2-1 Western blot

Western Blot using CPTC-CHP2-1 as primary Ab against CHP2 (rAg 10965) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-CHP2-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-CHP2-1 NCI 60 Protein Array

Protein Array in which CPTC-CHP2-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer  showing cytoplasmic staining using Antibody CPTC-CHP2-1. Titer: 1:20000 Click image to enlarge

CPTC-CHP2-1 IHC Tissue

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-CHP2-1. Titer: 1:20000

Background

Catalog Number:

CPTC-CHP2-2

Target Antigen:

Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

07/03/2014

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CHP2-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-CHP2-2 as primary Ab against CHP2 (rAg 10965) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CHP2-2 Western blot

Western Blot using CPTC-CHP2-2 as primary Ab against CHP2 (rAg 10965) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Background

Catalog Number:

CPTC-CHP2-3

Target Antigen:

Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

07/03/2014

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CHP2-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-CHP2-3 as primary Ab against CHP2 (rAg 10965) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CHP2-3 Western blot

Western Blot using CPTC-CHP2-3 as primary Ab against CHP2 (rAg 10965) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  NCI 60 Protein Array

CPTC-CHP2-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC Tissue

CPTC-CHP2-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC NCI60

CPTC-CHP2-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

NCI Identification Number:

10965

Antigen Name:

Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)

CPTC Name:

CPTC-CHP2

Keywords:

HCA520

Function:

Binds to and activates SLC9A1/NHE1 in a serum-independent manner, thus increasing pH and protecting cells from serum deprivation-induced death.

Chromosomal Localization:

16p12.1

Expression System:

E. Coli

NCBI Accession Number:

NM_022097.2

Swiss Prot Accession Number:

O43745

DNA Source:

OB : LIFESEQ2330165

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

4470

Buffers:

PBS

Expressed Sequence:

SNAMGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLS
RMDLQQIGALAVNPLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDED
TETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQ
VTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK

Native Sequence:

MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMD
LQQIGALAVNPLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTET
QDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTE
EQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK

Calculated Isoelectric Point:

5.89

Molecular Weight:

22.45

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image PAGE of CHP2 (rAg 10965) with molecular weight standards in lane 1
Click image to enlarge

CPTC-CHP2 SDS-PAGE

PAGE of CHP2 (rAg 10965) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com