Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)


Background

Catalog Number:

CPTC-CHP2-1

Target Antigen:

Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer  showing cytoplasmic staining using Antibody CPTC-CHP2-1. Titer: 1:20000 Click image to enlarge

CPTC-CHP2-1 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-CHP2-1. Titer: 1:20000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CHP2-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-CHP2-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-CHP2-1 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-CHP2-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CHP2-1 as primary Ab against CHP2 (rAg 10965) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CHP2-1 Western blot

Result: Positive

Western Blot using CPTC-CHP2-1 as primary Ab against CHP2 (rAg 10965) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-CHP2-2

Target Antigen:

Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CHP2-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CHP2-2 as primary Ab against CHP2 (rAg 10965) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CHP2-2 Western blot

Result: Positive

Western Blot using CPTC-CHP2-2 as primary Ab against CHP2 (rAg 10965) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-CHP2-3

Target Antigen:

Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-CHP2-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-CHP2-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CHP2-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-CHP2-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CHP2-3 as primary Ab against CHP2 (rAg 10965) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CHP2-3 Western blot

Result: Positive

Western Blot using CPTC-CHP2-3 as primary Ab against CHP2 (rAg 10965) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10965

Antigen Name:

Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)

CPTC Name:

CPTC-CHP2

Keywords:

HCA520

Function:

Binds to and activates SLC9A1/NHE1 in a serum-independent manner, thus increasing pH and protecting cells from serum deprivation-induced death.

Chromosomal Localization:

16p12.1

Expression System:

E. Coli

NCBI Accession Number:

NM_022097.2

Swiss Prot Accession Number:

O43745

DNA Source:

OB : LIFESEQ2330165

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

4470

Buffers:

PBS

Expressed Sequence:

SNAMGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLS
RMDLQQIGALAVNPLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDED
TETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQ
VTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK

Native Sequence:

MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMD
LQQIGALAVNPLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTET
QDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTE
EQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK

Calculated Isoelectric Point:

5.89

Molecular Weight:

22450

Last Updated:

11/06/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of CHP2 (rAg 10965) with molecular weight standards in lane 1
Click image to enlarge

CPTC-CHP2 SDS-PAGE

PAGE of CHP2 (rAg 10965) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com