Chromogranin A


Background

Catalog Number:

CPTC-CHGA-1

Target Antigen:

Chromogranin A

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-CHGA-1 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-CHGA-1 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CHGA-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-CHGA-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-CHGA-1 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-CHGA-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CHGA-1 as primary Ab against Ag 10131 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CHGA-1 Western Blot

Result: Positive

Western Blot using CPTC-CHGA-1 as primary Ab against Ag 10131 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-CHGA-2

Target Antigen:

Chromogranin A

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-CHGA-2 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-CHGA-2 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CHGA-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-CHGA-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-CHGA-2 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-CHGA-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CHGA-2 as primary Ab against Ag 10131 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CHGA-2 Western Blot

Result: Positive

Western Blot using CPTC-CHGA-2 as primary Ab against Ag 10131 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-CHGA-3

Target Antigen:

Chromogranin A

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-CHGA-3 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-CHGA-3 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CHGA-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-CHGA-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-CHGA-3 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-CHGA-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CHGA-3 as primary Ab against Ag 10131 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CHGA-3 Western Blot

Result: Positive

Western Blot using CPTC-CHGA-3 as primary Ab against Ag 10131 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10131

Antigen Name:

Chromogranin A

CPTC Name:

CPTC-CHGA

Keywords:

parathyroid secretory protein 1; CHGA; CGA; CgA; SP-I

Function:

The protein encoded by this gene is a member of the chromogranin/secretograninfamily of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown. Pancreastatin strongly inhibits glucose induced insulin release from the pancreas.

Chromosomal Localization:

14q32

Expression System:

E. Coli

NCBI Accession Number:

BC006459

Swiss Prot Accession Number:

P10645

DNA Source:

HIP:HsCD00003729

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

28023

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERI
LSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAE
LKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGN
NQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKG
LSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIR
KGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGL
FRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEED
NRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPE
EKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG

Native Sequence:

MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPM
PVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGF
EDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGAR
PQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAE
GDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGP
TVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHS
QQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAK
ELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSRE
DSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ
LQALRRG

Calculated Isoelectric Point:

4.57

Molecular Weight:

49077

Last Updated:

11/06/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10131 (with molecular weight standards in lane 1)
Click image to enlarge

Ag 10131

PAGE of Ag 10131 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com