PRINT

Annexin A1 (Annexin I)

Antibody: CPTC-ANXA1-1
Background

Catalog Number:

CPTC-ANXA1-1

RRID:

AB_10586631

Target Antigen:

Annexin A1 (Annexin I)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

05/23/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This file summarizes the results of pairing studies using SPR. (792.6 KB)

Pairing Studies

Result: Positive

This file summarizes the results of pairing studies using SPR.


Characterization SOP Files

  CyTOF
Click to enlarge image Imaging mass cytometry on ovarian cancer tissue core using CPTC-ANXA1-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, endometrium, testis, prostate, and lung) and cancer tissues (breast, lung, prostate, colon and ovarian). Click image to enlarge

CPTC-ANXA1-1 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on ovarian cancer tissue core using CPTC-ANXA1-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, endometrium, testis, prostate, and lung) and cancer tissues (breast, lung, prostate, colon and ovarian).


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (225.1 KB)

CPTC-ANXA1-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-ANXA1-1 for NCI60 Cell Line Array with titer 1:4900 0=NEGATIVE 1=WEAK(red) 2=MODERATE(blue) 3=STRONG(green) Click image to enlarge

CPTC-ANXA1-1 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-ANXA1-1 for NCI60 Cell Line Array with titer 1:4900
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-1. Titer: 1:4900 Click image to enlarge

CPTC-ANXA1-1 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-1. Titer: 1:4900


Characterization SOP Files

  IP
Download This PDF shows the results of immuno capture of annexin1 antigen by the CPTC ANXA1-1 antibody. (198.4 KB)

CPTC-ANXA1-1 ImmunoMS

Result: Positive

This PDF shows the results of immuno capture of annexin1 antigen by the CPTC ANXA1-1 antibody.


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol. Human assay: U-2 OS fixed with PFA, dilution: 1:2500 Human assay: U-251 MG fixed with PFA, dilution: 1:2500. Click image to enlarge

CPTC-ANXA1-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol. Human assay: U-2 OS fixed with PFA, dilution: 1:2500
Human assay: U-251 MG fixed with PFA, dilution: 1:2500.


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-ANXA1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-ANXA1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Click image to enlarge

CPTC-ANXA1-1NCI60 Protein Array

Result: Positive

Protein Array in which CPTC-ANXA1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500. Click image to enlarge

CPTC-ANXA1-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-ANXA1-1 as primary Ab against Ag 10278 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-ANXA1-1 Western Blot

Result: Positive

Western Blot using CPTC-ANXA1-1 as primary Ab against Ag 10278 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-ANXA1-1 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-ANXA1-1 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-ANXA1-1 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-ANXA1-2
Background

Catalog Number:

CPTC-ANXA1-2

RRID:

AB_10571934

Target Antigen:

Annexin A1 (Annexin I)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

05/23/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This file summarizes the results of pairing studies using SPR. (792.6 KB)

Pairing Studies

Result: Positive

This file summarizes the results of pairing studies using SPR.


Characterization SOP Files

  CyTOF
Click to enlarge image Imaging mass cytometry on lung cancer tissue core using CPTC-ANXA1-2 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (breast, lung, prostate, colon, and ovarian). Click image to enlarge

CPTC-ANXA1-2 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on lung cancer tissue core using CPTC-ANXA1-2 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (breast, lung, prostate, colon, and ovarian).


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (276.3 KB)

CPTC-ANXA1-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-ANXA1-2 for NCI60 Cell Line Array at titer 1:7000 0=NEGATIVE 1=WEAK(red) 2=MODERATE(blue) 3=STRONG(green) Titer: 1:3000 Click image to enlarge

CPTC-ANXA1-2 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-ANXA1-2 for NCI60 Cell Line Array at titer 1:7000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Titer: 1:3000


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-2. Titer: 1:3000 Click image to enlarge

CPTC-ANXA1-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-2. Titer: 1:3000


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-ANXA1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Download Protein Array in which Annexin 1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. (18.0 KB)

CPTC-ANXA1-2 NCI60 Protein Array

Result: Positive

Protein Array in which Annexin 1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-ANXA1-2 as primary Ab against Ag 10278 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-ANXA1-2 Western Blot

Result: Positive

Western Blot using CPTC-ANXA1-2 as primary Ab against Ag 10278 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-ANXA1-2 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-ANXA1-2 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-ANXA1-2 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-ANXA1-3
Background

Catalog Number:

CPTC-ANXA1-3

RRID:

AB_2227309

Target Antigen:

Annexin A1 (Annexin I)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

05/23/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Publications
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This file summarizes the results of pairing studies by SPR. (792.6 KB)

Pairing Studies

Result: Positive

This file summarizes the results of pairing studies by SPR.


Characterization SOP Files

  CyTOF
Click to enlarge image Imaging mass cytometry on breast cancer tissue core using CPTC-ANXA1-3 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (breast, lung, prostate, colon, and ovarian). Click image to enlarge

CPTC-ANXA1-3 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on breast cancer tissue core using CPTC-ANXA1-3 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (breast, lung, prostate, colon, and ovarian).


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (276.3 KB)

CPTC-ANXA1-3 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-ANXA1-3 for NCI60 Cell Line Array at titer 1:100 0=NEGATIVE 1=WEAK(red) 2=MODERATE(blue) 3=STRONG(green) Click image to enlarge

CPTC-ANXA1-3 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-ANXA1-3 for NCI60 Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-3. Titer: 1:100 Click image to enlarge

CPTC-ANXA1-3 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-3. Titer: 1:100


Characterization SOP Files

  IP
Download This PDF provides the results of Immuno MS using ANXA1-3 antibody and annexin 1 antigen. (375.2 KB)

CPTC-ANXA1-3 Immuno MS

Result: Negative

This PDF provides the results of Immuno MS using ANXA1-3 antibody and annexin 1 antigen.


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-ANXA1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-ANXA1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Click image to enlarge

CPTC-ANXA1-3 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-ANXA1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-ANXA1-3 as primary Ab against Ag 10278 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-ANXA1-3 Western Blot

Result: Positive

Western Blot using CPTC-ANXA1-3 as primary Ab against Ag 10278 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-ANXA1-3 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-ANXA1-3 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-ANXA1-3 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antigen: Annexin A1 (Annexin I)
Background

NCI Identification Number:

10278

Antigen Name:

Annexin A1 (Annexin I)

CPTC Name:

CPTC-ANXA1

Aliases:

ANXA1; ANX1; Annexin-1; Chromobindin-9; LPC1; p35

Function:

Annexin I belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.

Chromosomal Localization:

9q12 - q21.2

Expression System:

E. Coli

Accession Number:

BC001275

UniProt Accession Number:

P04083

DNA Source:

HIP:HsCD00002583

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

22015

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGD
KGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVK
FLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSP
LNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

Native Sequence:

MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGI
SAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLT
PCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNT
HAAELWKNPTAFKKYLQETYSKQVTSQEP

Calculated Isoelectric Point:

6.56

Molecular Weight:

38987

Last Updated:

09/01/2008

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10278 (with molecular weight standards in lane 1)
Click image to enlarge

Ag 10278

PAGE of Ag 10278 (with molecular weight standards in lane 1)

[top]

SOPs

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]