Aldo-keto reductase family 1 member C2


Background

Catalog Number:

CPTC-AKR1C2-1

Target Antigen:

Aldo-keto reductase family 1 member C2

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

04/09/2013

Antigen Recognition(s):

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-AKR1C2-1 as primary Ab against Ag 10198 (lane 2). Also included are molecular wt. standards (lane 1) and the AKR1C2-1 mAb as control (lane 3). Click image to enlarge

CPTC-AKR1C2-1 Western Blot

Western Blot using CPTC-AKR1C2-1 as primary Ab against Ag 10198 (lane 2). Also included are molecular wt. standards (lane 1) and the AKR1C2-1 mAb as control (lane 3).

Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-AKR1C2-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  Cross Reactivity Data
Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens. Click image to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

  NCI 60 Protein Array

CPTC-AKR1C2-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-AKR1C2-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-AKR1C2-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC HPA
Download CPTC-AKR1C2-1.pdf (106.4 KB)

CPTC-AKR1C2-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-AKR1C2-2

Target Antigen:

Aldo-keto reductase family 1 member C2

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/25/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-AKR1C2-2 as primary Ab against Ag 10198 (lane 2). Also included are molecular wt. standards (lane 1) and the AKR1C2-2 mAb as control (lane 3). Click image to enlarge

CPTC-AKR1C2-2 Western Blot

Western Blot using CPTC-AKR1C2-2 as primary Ab against Ag 10198 (lane 2). Also included are molecular wt. standards (lane 1) and the AKR1C2-2 mAb as control (lane 3).

Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-AKR1C2-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  Cross Reactivity Data
Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens. Click image to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-AKR1C2-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-AKR1C2-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-AKR1C2-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC HPA
Download CPTC-AKR1C2-2.pdf (93.0 KB)

CPTC-AKR1C2-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-AKR1C2-3

Target Antigen:

Aldo-keto reductase family 1 member C2

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-AKR1C2-3 as primary Ab against Ag 10198 (lane 2). Also included are molecular wt. standards (lane 1) and the AKR1C2-3 mAb as control (lane 3). Click image to enlarge

CPTC-AKR1C2-3 Western Blot

Western Blot using CPTC-AKR1C2-3 as primary Ab against Ag 10198 (lane 2). Also included are molecular wt. standards (lane 1) and the AKR1C2-3 mAb as control (lane 3).

Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-AKR1C2-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  Cross Reactivity Data
Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens. Click image to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-AKR1C2-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-AKR1C2-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-AKR1C2-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC HPA
Download CPTC-AKR1C2-3.pdf (91.3 KB)

CPTC-AKR1C2-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

NCI Identification Number:

10198

Antigen Name:

Aldo-keto reductase family 1 member C2

CPTC Name:

CPTC-AKR1C2

Keywords:

AKR1C2; 3-alpha-HSD3; AKR1C-pseudo; BABP; DD; DD-2; DD/BABP; DD2; DDH2; EC 1.-.-.-,EC 1.3.1.20,EC 1.1.1.213; HAKRD; HBAB; MCDR2; OTTHUMP00000018995; OTTHUMP00000044759

Function:

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Has a high bile-binding ability.

Chromosomal Localization:

10p15-p14

Expression System:

E. Coli

NCBI Accession Number:

BC007024

Swiss Prot Accession Number:

P52895

DNA Source:

HIP : HsCD00004147

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

37548

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFH
HIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRP
ALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCAT
WEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYF
NQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKK
HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAID
GLNRNVRYLTLDIFAGPPNYPFSDEY

Native Sequence:

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHID
SAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALE
RSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEA
MEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQR
KLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKR
TPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY

Calculated Isoelectric Point:

7.12

Molecular Weight:

37008

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens.
Click image to enlarge

Ag 10198 PAGE

PAGE of CPTC-AKR1C2 (Ag 10198),with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com