Skip to Content

Geminin

Antibody: CPTC-GMNN-1

Background

Catalog Number:
CPTC-GMNN-1
Target Antigen:
Geminin
Isotype:
IgG1
Species:
Mouse
Last Updated:
07/12/2016
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-GMNN-1 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-GMNN-1 Western blot

Western Blot using CPTC-GMNN-1 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GMNN-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-GMNN-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-GMNN-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-GMNN-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-GMNN-1.pdf (109.2 KB)

CPTC-GMNN-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-GMNN-2

Background

Catalog Number:
CPTC-GMNN-2
Target Antigen:
Geminin
Isotype:
IgG1
Species:
Mouse
Last Updated:
07/12/2016
Antigen Recognition(s):

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-GMNN-2 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-GMNN-2 Western blot

Western Blot using CPTC-GMNN-2 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GMNN-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer  showing nuclear staining using Antibody CPTC-GMNN-2. Titer: 1:800
Click to enlarge

CPTC-GMNN-2 IHC Tissue

Tissue Micro-Array(TMA) core of lung cancer showing nuclear staining using Antibody CPTC-GMNN-2. Titer: 1:800

IHC HPA

Download CPTC-GMNN-2.pdf (98.1 KB)

CPTC-GMNN-2 Evaluation by

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-GMNN-3

Background

Catalog Number:
CPTC-GMNN-3
Target Antigen:
Geminin
Isotype:
IgG2b
Species:
Mouse
Last Updated:
07/12/2016
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-GMNN-3 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-GMNN-3 Western blot

Western Blot using CPTC-GMNN-3 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GMNN-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-GMNN-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-GMNN-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-GMNN-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-GMNN-3.pdf (95.7 KB)

CPTC-GMNN-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antigen: Geminin

Background

NCI Identification Number:
10987
Antigen Name:
Geminin
CPTC Name:
CPTC-GMNN
Keywords:
Gem; OTTHUMP00000039393; RP3-369A17.3; geminin
Function:
Inhibits DNA replication by preventing the incorporation of MCM complex into prereplication complex (pre-RC). It is degraded during the mitotic phase of the cell cycle. Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle.
Chromosomal Localization:
6p22.2
Expression System:
E. Coli
NCBI Accession Number:
BC005185.1
Swiss Prot Accession Number:
O75496
DNA Source:
OB : MHS1011-62496
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
10033
Buffers:
PBS
Expressed Sequence:
SNAMNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGR
ENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQ
ESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQ
KDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESL
DNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Native Sequence:
MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGREN
ELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQE
SFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQ
KDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFES
LDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Calculated Isoelectric Point:
4.93
Molecular Weight:
23.57
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GMNN PAGE

PAGE of Ag 10987 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com