Zinc Finger, AN1-type Domain 6


Background

Catalog Number:

CPTC-ZFAND6-1

RRID:

AB_2617386

Target Antigen:

Zinc Finger, AN1-type Domain 6

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

08/25/2021

Antigen Recognition(s):

Recombinant Full-length

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA

CPTC-ZFAND6-1 Evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-ZFAND6-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-ZFAND6-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-ZFAND6-1 as primary Ab against ZFAND6 (rAg 00014) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-ZFAND6-1 Western blot

Result: Positive

Western Blot using CPTC-ZFAND6-1 as primary Ab against ZFAND6 (rAg 00014) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-ZFAND6-2

RRID:

AB_2617387

Target Antigen:

Zinc Finger, AN1-type Domain 6

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

08/25/2021

Antigen Recognition(s):

Recombinant Full-length

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA

CPTC-ZFAND6-2 Evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-ZFAND6-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-ZFAND6-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-ZFAND6-2 as primary Ab against ZFAND6 (rAg 00014) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-ZFAND6-2 Western blot

Result: Positive

Western Blot using CPTC-ZFAND6-2 as primary Ab against ZFAND6 (rAg 00014) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-ZFAND6-3

RRID:

AB_2617388

Target Antigen:

Zinc Finger, AN1-type Domain 6

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

08/25/2021

Antigen Recognition(s):

Recombinant Full-length

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA

CPTC-ZFAND6-3 Evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-ZFAND6-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-ZFAND6-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-ZFAND6-3 as primary Ab against ZFAND6 (rAg 00014) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-ZFAND6-3 Western blot

Result: Positive

Western Blot using CPTC-ZFAND6-3 as primary Ab against ZFAND6 (rAg 00014) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

00014

Antigen Name:

Zinc Finger, AN1-type Domain 6

CPTC Name:

CPTC-ZFAND6

Keywords:

AWP1; ZA20D3; ZFAND5B; zinc finger, A20 domain containing 3; AN1-type zinc finger protein 6; protein associated with PRK1; Associated with PRK1 protein; Zinc finger A20 domain-containing protein 3

Function:

Involved in regulation of TNF-alpha induced NF-kappa-B activation and apoptosis. Involved in modulation of 'Lys-48'-linked polyubiquitination status of TRAF2 and decreases association of TRAF2 with RIPK1. Required for PTS1 target sequence-dependent protein import into peroxisomes and PEX5 stability; may cooperate with PEX6. In vitro involved in PEX5 export from the cytosol to peroxisomes.

Chromosomal Localization:

15q25.1

Expression System:

E.coli

NCBI Accession Number:

NM_019006

UniProt Accession Number:

Q6FIF0

DNA Source:

Imagenes

Immunogen:

Recombinant Full Length Protein

Vector Name:

pNIC28-Bsa4

Extinction Coefficient:

Buffers:

NaP

Expressed Sequence:

MHHHHHHSSGVDLGTENLYFQSMAQETNHSQVPMLCSTGCGFYGNPRTNG
MCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSAL
DSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDVQASVSDTA
QQPSEEQSKPLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDV
LNCSYNYKADAAEKIRKENPVVVGEKIQK

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

24981

Last Updated:

04/17/2013

Links

Characterization Data

Gel

Click to enlarge image PAGE of ZFAND6 (rAg 00014) with molecular weight standards in lane 1.
Click image to enlarge

CPTC-ZFAND6 PAGE

PAGE of ZFAND6 (rAg 00014) with molecular weight standards in lane 1.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com