Catalog Number:
CPTC-YWHAB-1
RRID:
AB_2617380
Target Antigen:
Tyrosine 3-Monooxygenase or Tryptophan 5-Monooxygenase Activation protein, Beta polypeptide
Isotype:
IgG2c
Species:
Mouse Monoclonal Antibody
Last Updated:
01/04/2023
Antigen Recognition(s):
Recombinant Full-length
SOP:
Result: Negative
This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: Negative
This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.
Result: Negative
This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.
Result: Positive
Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U2OS shows localization to cytosol. Human assay: THP-1 fixed with PFA, dilution: 1:100
Human assay: U2OS fixed with PFA, dilution: 1:100
Result: High Binding
Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Result: Negative
This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Result: Positive
Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%).
Analysis performed using a standard panel of samples. Antibody Dilution 1:500
Result: Positive
Western Blot using CPTC-YWHAB-1 as primary Ab against YWHAB (rAg 10981) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Catalog Number:
CPTC-YWHAB-2
RRID:
AB_2617381
Target Antigen:
Tyrosine 3-Monooxygenase or Tryptophan 5-Monooxygenase Activation protein, Beta polypeptide
Isotype:
IgG1
Species:
Mouse Monoclonal Antibody
Last Updated:
01/03/2024
Antigen Recognition(s):
Recombinant Full-length, Endogenous
SOP:
Result: Negative
This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: Negative
This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.
Result: Negative
This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.
Result: High Binding
Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Result: Negative
This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Result: Positive
Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:500
Result: Positive
Western Blot using CPTC-YWHAB-2 as primary Ab against YWHAB (rAg 10981) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Catalog Number:
CPTC-YWHAB-3
RRID:
AB_2617382
Target Antigen:
Tyrosine 3-Monooxygenase or Tryptophan 5-Monooxygenase Activation protein, Beta polypeptide
Isotype:
IgG2b
Species:
Mouse Monoclonal Antibody
Last Updated:
05/15/2025
Antigen Recognition(s):
Recombinant Full-length, Endogenous
SOP:
Result: Positive
Imaging mass cytometry on ovarian cancer tissue core using CPTC-YWHAB-3 metal-labeled antibody. Data shows overlay of target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (breast, colon, ovarian, lung, and prostate).
Result: Positive
This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: Negative
This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.
Result: Negative
This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.
Result: High Binding
Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Result: Negative
This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Result: Positive
Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:500
Result: Positive
Western Blot using CPTC-YWHAB-3 as primary Ab against YWHAB (rAg 10981) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
NCI Identification Number:
10981
Antigen Name:
Tyrosine 3-Monooxygenase or Tryptophan 5-Monooxygenase Activation protein, Beta polypeptide
CPTC Name:
CPTC-YWHAB
Aliases:
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alpha polypeptide; Protein 1054; Protein kinase C inhibitor Protein 1; KCIP-1; 14-3-3 alpha; 14-3-3 protein beta/alpha; GW128; HS1; YWHAA; brain protein 14-3-3, beta isoforms; protein kinase C inhibitor protein 1
Function:
This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. 
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling
pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif.
Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis.
14.3.3 proteins are a group of highly conserved proteins that are involved in many vital cellular processes such as metabolism, protein trafficking, signal transduction, apoptosis and cell cycle regulation. 14.3.3 proteins are phospho-serine/phospho-threonine binding proteins that have a diverse array of partners including transcription factors, biosynthetic enzymes, cytoskeletal proteins, signalling molecules, apoptosis factors and tumour suppressors. The 14.3.3 family consists of 7 isoforms; beta, gamma, epsilon, sigma, zeta, tau and eta. 14.3.3 proteins are ubiquitously expressed and self assemble into homo- and heterodimers, with the exception of 14.3.3sigma, which exclusively forms homodimers and is found in cells of epithelial origin only. Each monomer contains an independent ligand-binding site, thus the 14.3.3 dimer can interact with two target proteins simultaneously. 14.3.3 proteins are highly rigid structures and ligand binding can induce conformational changes that alter the stability and/or catalytic activity of the ligand. Furthermore, 14.3.3 protein binding can physically occlude sequence-specific or structural motifs on the target that prevent molecular interactions and/or modulate the accessibility of a target protein to modifying enzymes such as kinases, phosphatases and proteases. In addition, 14.3.3 proteins can act as a scaffold molecule to anchor target proteins within close proximity of one another. 14.3.3 proteins represent an integration point for proliferative, survival, apoptotic and stress signalling pathways. Members of the 14.3.3 protein family enhance the activity of many proteins with proliferative and/or survival functions, such as Raf kinases, and antagonise the activity of proteins that promote cell death and senescence, such as Bad, Bim and Bax. In contrast, 14.3.3sigma acts as a tumour suppressor and its expression is upregulated coordinately with p53 and BRAC1. This isoform sequesters cdk1-cyclin B complexes in the cytoplasm, and thus delays cell cycle progression. 14.3.3sigma is also a crucial regulator of translation during mitosis. Because many 14.3.3 interactions are phosphorylation dependent, 14.3.3 proteins have been integrated into the core regulatory pathways that are crucial for normal growth and development. 14.3.3 proteins are directly involved in cellular processes such as cytokinesis, cell-contact inhibition, anchorage-independent growth and cell adhesion, and it is these pathways that often become dysregulated in disease states such as cancer.
Chromosomal Localization:
20q13.1
Expression System:
E. Coli
Accession Number:
BC001359.2
UniProt Accession Number:
P31946
DNA Source:
OpenBiosystems - MHS1011-59035
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
27453
Buffers:
PBS without Ca++ and Mg++
Expressed Sequence:
SNAMTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLS
VAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICN
DVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNS
QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTA
FDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Native Sequence:
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAY
KNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVL
ELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQA
YQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDE
AIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Calculated Isoelectric Point:
4.76
Molecular Weight:
28355
Last Updated:
08/22/2020
PAGE of YWHAB (rAg 10981) with molecular weight standards in lane 1
Get it for free at Adobe.com