Ubiquitin Conjugating Enzyme E2E2


Background

Catalog Number:

CPTC-UBE2E2-1

Target Antigen:

Ubiquitin Conjugating Enzyme E2E2

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-UBE2E2-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-UBE2E2-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-UBE2E2-1 as primary Ab against UBE2E2 (rAg 00015) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-UBE2E2-1 Western blot

Result: Positive

Western Blot using CPTC-UBE2E2-1 as primary Ab against UBE2E2 (rAg 00015) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-UBE2E2-2

Target Antigen:

Ubiquitin Conjugating Enzyme E2E2

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-UBE2E2-2. Titer: 1:6000 Click image to enlarge

CPTC-UBE2E2-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-UBE2E2-2. Titer: 1:6000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-UBE2E2-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-UBE2E2-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-UBE2E2-2 as primary Ab against UBE2E2 (rAg 00015) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-UBE2E2-2 Western blot

Result: Positive

Western Blot using CPTC-UBE2E2-2 as primary Ab against UBE2E2 (rAg 00015) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-UBE2E2-3

Target Antigen:

Ubiquitin Conjugating Enzyme E2E2

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-UBE2E2-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-UBE2E2-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-UBE2E2-3 as primary Ab against UBE2E2 (rAg 00015) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-UBE2E2-3 Western blot

Result: Positive

Western Blot using CPTC-UBE2E2-3 as primary Ab against UBE2E2 (rAg 00015) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

00015

Antigen Name:

Ubiquitin Conjugating Enzyme E2E2

CPTC Name:

CPTC-UBE2E2

Keywords:

Ubiquitin-Conjugating Enzyme E2E 2; Yeast UBC4/5; Ubiquitin-Conjugating Enzyme E2E 2; UbcH8; Ubiquitin Carrier Protein E2; Ubiquitin-Protein Ligase E2; UBCH8; EC 6.3.2.19; FLJ25157

Function:

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination.

Chromosomal Localization:

3p24.2

Expression System:

E.coli

NCBI Accession Number:

Q96LR5

Swiss Prot Accession Number:

Q96LR5

DNA Source:

Imagenes

Immunogen:

Recombinant Full Length Protein

Vector Name:

pNIC28-Bsa4

Extinction Coefficient:

Buffers:

NaP

Expressed Sequence:

MHHHHHHSSGVDLGTENLYFQSMKISSKTAAKLSTSAKRIQKELAEITLD
PPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPK
VTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPA
DPLVGSIATQYMTNRAEHDRMARQWTKRYAT

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

20251

Last Updated:

06/03/2013

Links

Characterization Data

Gel

Click to enlarge image PAGE of UBE2E2 (rAg 00015) with molecular weight standards in lane 1.
Click image to enlarge

CPTC-UBE2E2 PAGE

PAGE of UBE2E2 (rAg 00015) with molecular weight standards in lane 1.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com