Ubiquitin-like modifier activating enzyme 1


Background

Catalog Number:

CPTC-UBA1-1

Target Antigen:

Ubiquitin-like modifier activating enzyme 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-UBA1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-UBA1-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-UBA1-1 as primary Ab against UB2L6 (rAg 00057) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-UBA1-1 Western blot

Result: Positive

Western Blot using CPTC-UBA1-1 as primary Ab against UB2L6 (rAg 00057) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

Background

Catalog Number:

CPTC-UBA1-2

Target Antigen:

Ubiquitin-like modifier activating enzyme 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-UBA1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-UBA1-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-UBA1-2 as primary Ab against UB2L6 (rAg 00057) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-UBA1-2 Western blot

Result: Positive

Western Blot using CPTC-UBA1-2 as primary Ab against UB2L6 (rAg 00057) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

Background

Catalog Number:

CPTC-UBA1-3

Target Antigen:

Ubiquitin-like modifier activating enzyme 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-UBA1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-UBA1-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-UBA1-3 as primary Ab against UB2L6 (rAg 00057) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-UBA1-3 Western blot

Result: Positive

Western Blot using CPTC-UBA1-3 as primary Ab against UB2L6 (rAg 00057) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

Background

NCI Identification Number:

00057

Antigen Name:

Ubiquitin-like modifier activating enzyme 1

CPTC Name:

CPTC-UBA1

Keywords:

UBE1; A1S9T; GXP1; POC20; UBE1X; Ubiquitin-Activating Enzyme E1; A1ST; AMCX1; SMAX2; A1S9; UBA1A; A1S9T And BN75 Temperature Sensitivity Complementing; POC20 Centriolar Protein Homolog; UBA1, Ubiquitin-Activating Enzyme E1 Homolog A; Ubiquitin-Like Modifier-Activating Enzyme 1; Protein A1S9

Function:

The protein encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described.

Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thioester and free AMP.

Chromosomal Localization:

XP11.23

Expression System:

E. coli

NCBI Accession Number:

NP_695012.1

Swiss Prot Accession Number:

P22314

DNA Source:

mammalian Gene Collection

Immunogen:

Recombinant Full Length Protein

Vector Name:

pET 28-MHL

Extinction Coefficient:

Buffers:

PBS pH 7.4

Expressed Sequence:

mhhhhhhssgrenlyfqgGSEADIDEGLYSRQLYVLGHEAMKRLQTSSVL
VSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKN
RAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVG
EFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTK
DNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFS
ICDTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVVTDFAKFSRP
AQLHIGFQALHQFCAQHGRPPRPRNEEDAAELVALAQAVNARALPAVQQN
NLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPIMQWLYF
DALECLPEDKEVLTEDKCLQRQNRYDGQVAVFGSDLQEKLGKQKYFLVGA
GAIGCELLKNFAMIGLGCGEGGEIIVTDMDTIEKSNLNRQFLFRPWDVTK
LKSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIYDDDFFQNLDGVANALD
NVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPE
KSIPICTLKNFPNAIEHTLQWARDEFEGLFKQPAENVNQYLTDPKFVERT
LRLAGTQPLEVLEAVQRSLVLQRPQTWADCVTWACHHWHTQYSNNIRQLL
HNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTY
GLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRL
EELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIP
SADRHKSKLIAG

Native Sequence:

Calculated Isoelectric Point:

5.2

Molecular Weight:

95916

Last Updated:

11/26/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of UBA1 (rAg 00057) with molecular weight standards in lane 1
Click image to enlarge

CPTC-UBA1 PAGE

PAGE of UBA1 (rAg 00057) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com