Ubiquitin Conjugating Enzyme E2L 6


Background

Catalog Number:

CPTC-UB2L6-1

Target Antigen:

Ubiquitin Conjugating Enzyme E2L 6

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-UB2L6-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-UB2L6-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-UB2L6-1 as primary Ab against UB2L6 (rAg 00012) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-UB2L6-1 Western blot

Result: Positive

Western Blot using CPTC-UB2L6-1 as primary Ab against UB2L6 (rAg 00012) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-UB2L6-2

Target Antigen:

Ubiquitin Conjugating Enzyme E2L 6

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-UB2L6-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-UB2L6-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-UB2L6-2 as primary Ab against UB2L6 (rAg 00012) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-UB2L6-2 Western blot

Result: Positive

Western Blot using CPTC-UB2L6-2 as primary Ab against UB2L6 (rAg 00012) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-UB2L6-3

Target Antigen:

Ubiquitin Conjugating Enzyme E2L 6

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-UB2L6-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-UB2L6-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-UB2L6-3 as primary Ab against UB2L6 (rAg 00012) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-UB2L6-3 Western blot

Result: Positive

Western Blot using CPTC-UB2L6-3 as primary Ab against UB2L6 (rAg 00012) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

Background

NCI Identification Number:

00012

Antigen Name:

Ubiquitin Conjugating Enzyme E2L 6

CPTC Name:

CPTC-UB2L6

Keywords:

ubiquitin-conjugating enzyme E2L 6; UBCH8; Retinoic acid-induced gene B protein; Ubiquitin carrier protein L6; Ubiquitin-protein ligase L6; RIG-B; EC 6.3.2.19; retinoic acid induced gene B protein; ubiquitin/ISG15-conjugating enzyme E2 L6; UbcH8

Function:

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by the UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Promotes ubiquitination and subsequent proteasomal degradation of FLT3.

Chromosomal Localization:

11q12.1

Expression System:

E.coli

NCBI Accession Number:

NP_004214

Swiss Prot Accession Number:

O14933

DNA Source:

Imagenes

Immunogen:

Recombinant Full Length Protein

Vector Name:

pNIC28-Bsa4

Extinction Coefficient:

Buffers:

NaP

Expressed Sequence:

MHHHHHHSSGVDLGTENLYFQSMASMRVVKELEDLQKKPPPYLRNLSSDD
ANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNV
DENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLL
TQNPELFRKNAEEFTLRFGVDRPS

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

20190

Last Updated:

04/09/2013

Links

Characterization Data

Gel

Click to enlarge image PAGE of rAg 00012 (with molecular weight standards in lane 1)
Click image to enlarge

CPTC-UB2L6 PAGE

PAGE of rAg 00012 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com