Topoisomerase I Mitochondrial


Background

Catalog Number:

CPTC-TOP1MT-1

RRID:

AB_2617395

Target Antigen:

Topoisomerase I Mitochondrial

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TOP1MT-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-TOP1-1 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TOP1MT-1 as primary Ab against recombinant topoisomerase1 MT (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TOP1-1 Western blot

Result: Positive

Western Blot using CPTC-TOP1MT-1 as primary Ab against recombinant topoisomerase1 MT (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-TOP1MT-2

RRID:

AB_2617396

Target Antigen:

Topoisomerase I Mitochondrial

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TOP1MT-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-TOP1-2 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TOP1MT-2 as primary Ab against recombinant topoisomerase1 MT (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TOP1MT-2 Western blot

Result: Positive

Western Blot using CPTC-TOP1MT-2 as primary Ab against recombinant topoisomerase1 MT (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-TOP1MT-3

RRID:

AB_2617397

Target Antigen:

Topoisomerase I Mitochondrial

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TOP1MT-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-TOP1-3 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TOP1-3 as primary Ab against recombinant topoisomerase1 MT (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TOP1MT-3 Western blot

Result: Positive

Western Blot using CPTC-TOP1-3 as primary Ab against recombinant topoisomerase1 MT (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

00001

Antigen Name:

Topoisomerase I Mitochondrial

CPTC Name:

CPTC-TOP1MT

Keywords:

topoisomerase (DNA) I, mitochondrial; EC 5.99.1.2; mitochondrial DNA topoisomerase 1; TOP1mt

Function:

Releases the supercoiling and torsional tension of DNA introduced during duplication of mitochondrial DNA by
transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine
of the enzyme, resulting in the formation of a DNA-(3'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 5'-OH DNA strand. The free DNA strand than undergoes passage around the unbroken strand thus removing DNA supercoils. Finally, in the religation step, the DNA 5'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone

Chromosomal Localization:

8q24.3

Expression System:

E. coli

NCBI Accession Number:

NM_052963

UniProt Accession Number:

Q969P6

DNA Source:

PEL:7387-X02-605

Immunogen:

Recombinant Full Length Protein

Vector Name:

pDest-605

Extinction Coefficient:

Buffers:

Expressed Sequence:

MRVVRLLRLRAALTLLGEVPRRPASRGVPGSRRTQKGSGARWEKEKHEDG
VKWRQLEHKGPYFAPPYEPLPDGVRF FYEGRPVRLSVAAEEVATFYGRM
LDHEYTTKEVFRKNFFNDWRKEMAVEEREVIKSLDKCDFTEIHRYFVDKA
AAR KVLSREEKQKLKEEAEKLQQEFGYCILDGHQEKIGNFKIEPPGLFR
GRGDHPKMGMLKRRITPEDVVINCSRDSKI PEPPAGHQWKEVRSDNTVT
WLAAWTESVQNSIKYIMLNPCSKLKGETAWQKFETARRLRGFVDEIRSQY
RADWKSR EMKTRQRAVALYFIDKLALRAGNEKEDGEAADTVGCCSLRVE
HVQLHPEADGCQHVVEFDFLGKDCIRYYNRVPVE KPVYKNLQLFMENKD
PRDDLFDRLTTTSLNKHLQELMDGLTAKVFRTYNASITLQEQLRALTRAE
DSIAAKILSYN RANRVVAILCNHQRATPSTFEKSMQNLQTKIQAKKEQV
AEARAELRRARAEHKAQGDGKSRSVLEKKRRLLEKLQE QLAQLSVQATD
KEENKQVALGTSKLNYLDPRISIAWCKRFRVPVEKIYSKTQRERFAWALA
MAGEDFEF

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

69872

Last Updated:

11/05/2010

Links

Characterization Data

Gel

Click to enlarge image PAGE of recombinant Topoisomerase1 MT (CPTC-TOP1MT) (with molecular weight standards in lane 1)
Click image to enlarge

CPTC-TOP1MT

PAGE of recombinant Topoisomerase1 MT (CPTC-TOP1MT) (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com