PRINT

Tyrosine Kinase Non Receptor 2

Antibody: CPTC-TNK2-1
Background

Catalog Number:

CPTC-TNK2-1

RRID:

AB_2877110

Target Antigen:

Tyrosine Kinase Non Receptor 2

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

08/24/2022

Antigen Recognition(s):

Peptide

Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (342.0 KB)

CPTC-TNK2-1 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Immuno-MRM

CPTC-TNK2-1 iMRM (synthetic peptide)

Result: Negative

Immuno-MRM screening of antibody CPTC-TNK2-1 against phosphorylated synthetic peptide KKVSSTH(pY)YLLPERP (Tyrosine Kinase Non Receptor 2 Peptide 1), phosphorylated synthetic peptide KKVSSTHY(pY)LLPERP (Tyrosine Kinase Non Receptor 2 Peptide 2),and their correspondent non-phosphorylated peptide (KKVSSTHYYLLPERP). The antibody was not able to pull down any of the phosphorylated or non-phosphorylated peptides.


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-TNK2-1 as primary antibody against CPTC-TNK2 peptide. Click image to enlarge

CPTC-TNK2-1 Indirect ELISA

Result: Positive

Indirect ELISA using CPTC-TNK2-1 as primary antibody against CPTC-TNK2 peptide.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TNK2-1 as primary antibody against TNK2 recombinant protein (lane 2). Molecular weight standards are also included (lane 1). Click image to enlarge

CPTC-TNK2-1 Western Blot (Recombinant Protein)

Result: Positive

Western Blot using CPTC-TNK2-1 as primary antibody against TNK2 recombinant protein (lane 2). Molecular weight standards are also included (lane 1).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot usign CPTC-TNK2-1 as primary antibody against cell lysates of MDA-MB-231 cells treated (lane 2) and not treated (lane 3) with EGF (100 ng/mL0 for 10 minutes, after overnight starvation. Molecular weight standards are also included (lane 1). The antibody was not able to detect the not phosphorylated and/or phosphrylated target protein in the EGF treated and not treated cell lysate. Expected molecultar weight for TNK2 is about 114 KDa. Click image to enlarge

CPTC-TNK2-1 western blot with lysates

Result: Negative

Western Blot usign CPTC-TNK2-1 as primary antibody against cell lysates of MDA-MB-231 cells treated (lane 2) and not treated (lane 3) with EGF (100 ng/mL0 for 10 minutes, after overnight starvation. Molecular weight standards are also included (lane 1). The antibody was not able to detect the not phosphorylated and/or phosphrylated target protein in the EGF treated and not treated cell lysate. Expected molecultar weight for TNK2 is about 114 KDa.


Characterization SOP Files

[top]

Antibody: CPTC-TNK2-2
Background

Catalog Number:

CPTC-TNK2-2

RRID:

AB_2877111

Target Antigen:

Tyrosine Kinase Non Receptor 2

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

08/24/2022

Antigen Recognition(s):

Peptide

Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (288.7 KB)

CPTC-TNK2-2 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Immuno-MRM

CPTC-TNK2-2 iMRM (synthetic peptide)

Result: Negative

Immuno-MRM screening of antibody CPTC-TNK2-2 against phosphorylated synthetic peptide KKVSSTH(pY)YLLPERP (Tyrosine Kinase Non Receptor 2 Peptide 1), phosphorylated synthetic peptide KKVSSTHY(pY)LLPERP (Tyrosine Kinase Non Receptor 2 Peptide 2),and their correspondent non-phosphorylated peptide (KKVSSTHYYLLPERP). The antibody was not able to pull down any of the phosphorylated or non-phosphorylated peptides.


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-TNK2-2 as primary antibody against CPTC-TNK2 peptide. Click image to enlarge

CPTC-TNK2-2 Indirect ELISA

Result: Positive

Indirect ELISA using CPTC-TNK2-2 as primary antibody against CPTC-TNK2 peptide.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TNK2-2 as primary antibody against TNK2 recombinant protein (lane 2). Molecular weight standards are also included (lane 1). Click image to enlarge

CPTC-TNK2-2 Western Blot (Recombinant Protein)

Result: Positive

Western Blot using CPTC-TNK2-2 as primary antibody against TNK2 recombinant protein (lane 2). Molecular weight standards are also included (lane 1).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot usign CPTC-TNK2-2 as primary antibody against cell lysates of MDA-MB-231 cells treated (lane 2) and not treated (lane 3) with EGF (100 ng/mL0 for 10 minutes, after overnight starvation). Molecular weight standards are also included (lane 1). The antibody was not able to detect the not phosphorylated and/or phosphrylated target protein in the EGF treated and not treated cell lysate. Expected molecultar weight for TNK2 is about 114 KDa. Click image to enlarge

CPTC-TNK2-2 western blot with lysates

Result: Negative

Western Blot usign CPTC-TNK2-2 as primary antibody against cell lysates of MDA-MB-231 cells treated (lane 2) and not treated (lane 3) with EGF (100 ng/mL0 for 10 minutes, after overnight starvation). Molecular weight standards are also included (lane 1). The antibody was not able to detect the not phosphorylated and/or phosphrylated target protein in the EGF treated and not treated cell lysate. Expected molecultar weight for TNK2 is about 114 KDa.


Characterization SOP Files

[top]

Antibody: CPTC-TNK2-3
Background

Catalog Number:

CPTC-TNK2-3

RRID:

AB_2877112

Target Antigen:

Tyrosine Kinase Non Receptor 2

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

08/24/2022

Antigen Recognition(s):

Peptide, Endogenous

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (364.7 KB)

CPTC-TNK2-3 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Immuno-MRM

CPTC-TNK2-3 iMRM (synthetic peptide)

Result: Negative

Immuno-MRM screening of antibody CPTC-TNK2-3 against phosphorylated synthetic peptide KKVSSTH(pY)YLLPERP (Tyrosine Kinase Non Receptor 2 Peptide 1), phosphorylated synthetic peptide KKVSSTHY(pY)LLPERP (Tyrosine Kinase Non Receptor 2 Peptide 2),and their correspondent non-phosphorylated peptide (KKVSSTHYYLLPERP). The antibody was not able to pull down any of the phosphorylated or non-phosphorylated peptides.


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-TNK2-3 as primary antibody against CPTC-TNK2 peptide. Click image to enlarge

CPTC-TNK2-3 Indirect ELISA

Result: Positive

Indirect ELISA using CPTC-TNK2-3 as primary antibody against CPTC-TNK2 peptide.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TNK2-3 as primary antibody against TNK2 recombinant protein (lane 2). Molecular weight standards are also included (lane 1). Click image to enlarge

CPTC-TNK2-3 Western Blot (Recombinant Protein)

Result: Positive

Western Blot using CPTC-TNK2-3 as primary antibody against TNK2 recombinant protein (lane 2). Molecular weight standards are also included (lane 1).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot usign CPTC-TNK2-3 as primary antibody against cell lysates of MDA-MB-231 cells treated (lane 2) and not treated (lane 3) with EGF (100 ng/mL0 for 10 minutes, after overnight starvation). Molecular weight standards are also included (lane 1). The antibody was able to detect the not phosphorylated and phosphrylated target protein in the EGF treated and not treated cell lysate. Expected molecultar weight for TNK2 is about 114 KDa. Click image to enlarge

CPTC-TNK2-3 western blot with lysates

Result: Positive

Western Blot usign CPTC-TNK2-3 as primary antibody against cell lysates of MDA-MB-231 cells treated (lane 2) and not treated (lane 3) with EGF (100 ng/mL0 for 10 minutes, after overnight starvation). Molecular weight standards are also included (lane 1). The antibody was able to detect the not phosphorylated and phosphrylated target protein in the EGF treated and not treated cell lysate. Expected molecultar weight for TNK2 is about 114 KDa.


Characterization SOP Files

[top]

Antigen: Tyrosine Kinase Non Receptor 2

Background

NCI Identification Number:

00414

Antigen Name:

Tyrosine Kinase Non Receptor 2

CPTC Name:

CPTC-TNK2

Aliases:

Tyrosine Kinase Non Receptor 2; ACK1; Tyrosine Kinase Non-Receptor Protein 2; Activated Cdc42-Associated Kinase 1; Activated CDC42 Kinase 1; EC 2.7.10.2; P21cdc42Hs; ACK-1; ACK; Tyrosine Kinase, Non-Receptor, 2; Activated P21cdc42Hs Kinase; EC 2.7.11.1; EC 2.7.10; TNK2

Function:

This gene encodes a tyrosine kinase that binds Cdc42Hs in its GTP-bound form and inhibits both the intrinsic and GTPase-activating protein (GAP)-stimulated GTPase activity of Cdc42Hs. This binding is mediated by a unique sequence of 47 amino acids C-terminal to an SH3 domain. The protein may be involved in a regulatory mechanism that sustains the GTP-bound active form of Cdc42Hs and which is directly linked to a tyrosine phosphorylation signal transduction pathway. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined.TNK2 (Tyrosine Kinase Non Receptor 2) is a Protein Coding gene. Diseases associated with TNK2 include Infantile-Onset Mesial Temporal Lobe Epilepsy With Severe Cognitive Regression and Gastric Cardia Carcinoma. Among its related pathways are Actin Nucleation by ARP-WASP Complex and G13 Signaling Pathway. Gene Ontology (GO) annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is TNK1.Non-receptor tyrosine-protein and serine/threonine-protein kinase that is implicated in cell spreading and migration, cell survival, cell growth and proliferation. Transduces extracellular signals to cytosolic and nuclear effectors. Phosphorylates AKT1, AR, MCF2, WASL and WWOX. Implicated in trafficking and clathrin-mediated endocytosis through binding to epidermal growth factor receptor (EGFR) and clathrin. Binds to both poly- and mono-ubiquitin and regulates ligand-induced degradation of EGFR, thereby contributing to the accumulation of EGFR at the limiting membrane of early endosomes. Downstream effector of CDC42 which mediates CDC42-dependent cell migration via phosphorylation of BCAR1. May be involved both in adult synaptic function and plasticity and in brain development. Activates AKT1 by phosphorylating it on 'Tyr-176'. Phosphorylates AR on 'Tyr-267' and 'Tyr-363' thereby promoting its recruitment to androgen-responsive enhancers (AREs). Phosphorylates WWOX on 'Tyr-287'. Phosphorylates MCF2, thereby enhancing its activity as a guanine nucleotide exchange factor (GEF) toward Rho family proteins. Contributes to the control of AXL receptor levels. Confers metastatic properties on cancer cells and promotes tumor growth by negatively regulating tumor suppressor such as WWOX and positively regulating pro-survival factors such as AKT1 and AR. Phosphorylates WASP.

Chromosomal Localization:

3q29

Expression System:

E.coli

Accession Number:

NP_005772.3

UniProt Accession Number:

Q07912

DNA Source:

N/A

Immunogen:

Recombinant Domain

Vector Name:

pGEX1

Extinction Coefficient:

Buffers:

Expressed Sequence:

SPEEPTPLPVPLLLPPPSTPAPAAPTATVRPMPQAALDPKANFSTNNSNP
GARPPPPRATARLPQRGCPGDG (a.a. 881 to 952)

Native Sequence:

Calculated Isoelectric Point:

Molecular Weight:

5940

Last Updated:

09/15/2020

Links

Characterization Data

SOPs

No SOPs available.

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]