Tyrosyl-DNA Phosphodiesterase 2


Background

Catalog Number:

CPTC-TDP2-1

Target Antigen:

Tyrosyl-DNA Phosphodiesterase 2

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

06/12/2014

Antigen Recognition(s):

SOP:

Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TDP2-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-TDP2-1 as primary Ab against TDP2 (rAg 00005) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TDP2-1 Western blot

Western Blot using CPTC-TDP2-1 as primary Ab against TDP2 (rAg 00005) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  NCI 60 Protein Array

CPTC-TDP2-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-TDP2-2

Target Antigen:

Tyrosyl-DNA Phosphodiesterase 2

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

03/05/2015

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TDP2-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-TDP2-2 as primary Ab against TDP2 (rAg 00005) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TDP2-2 Western blot

Western Blot using CPTC-TDP2-2 as primary Ab against TDP2 (rAg 00005) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  NCI 60 Protein Array

CPTC-TDP2-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-TDP2-3

Target Antigen:

Tyrosyl-DNA Phosphodiesterase 2

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

06/12/2014

Antigen Recognition(s):

SOP:

Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TDP2-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-TDP2-3 as primary Ab against TDP2 (rAg 00005) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TDP2-3 Western blot

Western Blot using CPTC-TDP2-3 as primary Ab against TDP2 (rAg 00005) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  NCI 60 Protein Array

CPTC-TDP2-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

NCI Identification Number:

00005

Antigen Name:

Tyrosyl-DNA Phosphodiesterase 2

CPTC Name:

CPTC-TDP2

Keywords:

tyrosyl-DNA phosphodiesterase 2; EAPII; TTRAP; ETS1-associated protein 2; TRAF and TNF receptor associated protein; ETS1-associated protein II; Tyr-DNA phosphodiesterase 2; TRAF and TNF receptor-associated protein; 5'-Tyr-DNA phosphodiesterase; AD022; 5'-tyrosyl-DNA phosphodiesterase; dJ30M3.3; EAP2; EC 3.1.4

Function:

This gene encodes a member of a superfamily of divalent cation-dependent phosphodiesterases. The encoded protein associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor associated factors (TRAFs), and inhibits nuclear factor-kappa-B activation. This protein has sequence and structural similarities with APE1 endonuclease, which is involved in both DNA repair and the activation of transcription factors.

DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 5'-phosphodiester bond, giving rise to DNA with a free 5' phosphate. Catalyzes the hydrolysis of dead-end complexes
between DNA and the topoisomerase 2 (TOP2) active site tyrosine residue. Hydrolyzes 5'-phosphoglycolates on protruding 5' ends on DNA double-strand breaks (DSBs) due to DNA damage by radiation and free radicals. The 5'-tyrosyl DNA phosphodiesterase activity can enable the repair of TOP2-induced DSBs without the need for nuclease activity, creating a 'clean' DSB with 5'-phosphate termini that are ready for ligation. Has also 3'-tyrosyl DNA phosphodiesterase activity, but less efficiently and much slower than TDP1. May also act as a negative regulator of ETS1 and may inhibit nuclear factor-kappa-B activation.

Chromosomal Localization:

6p22.3 - p22.1

Expression System:

Baculovirus

NCBI Accession Number:

NM_016614

Swiss Prot Accession Number:

O95551

DNA Source:

xxx

Immunogen:

Recombinant Full Length Protein

Vector Name:

His6-GST tev

Extinction Coefficient:

Buffers:

Expressed Sequence:

MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAEN
DWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKI
SPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFL
QEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFP
STKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQE
APESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ
MNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSD
HWGLLCNLDIIL

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

40927

Last Updated:

11/28/2012

Links

Characterization Data

Gel

Click to enlarge image PAGE of TDP2 (Ag 00005) with molecular weight standards in lane 1
Click image to enlarge

CPTC-TDPS PAGE

PAGE of TDP2 (Ag 00005) with molecular weight standards in lane 1

SOPs

No SOPs available.

Don't have Adobe Reader™?

Get it for free at Adobe.com