Tumor-associated Calcium Signal Transducer 2


Background

Catalog Number:

CPTC-TACSTD2-1

Target Antigen:

Tumor-associated Calcium Signal Transducer 2

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This table shows the data for pairing of the three CPTC-TACSTD2 antibodies. (792.7 KB)

CPTC-TACSTD2-1 Pairing Data

Result: Positive

This table shows the data for pairing of the three CPTC-TACSTD2 antibodies.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TACSTD2-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-TACSTD2-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TACSTD2-1 as primary Ab against TDP2 (rAg 00007) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TACSTD2-1 Western blot

Result: Positive

Western Blot using CPTC-TACSTD2-1 as primary Ab against TDP2 (rAg 00007) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-TACSTD2-2

Target Antigen:

Tumor-associated Calcium Signal Transducer 2

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This table shows the data for pairing of the three CPTC-TACSTD2 antibodies. (792.7 KB)

CPTC-TACSTD2-2 pairing data

Result: Positive

This table shows the data for pairing of the three CPTC-TACSTD2 antibodies.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TACSTD2-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-TACSTD2-2 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TACSTD2-2 as primary Ab against TDP2 (rAg 00007) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TACSTD2-2 Western blot

Result: Positive

Western Blot using CPTC-TACSTD2-2 as primary Ab against TDP2 (rAg 00007) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

Background

Catalog Number:

CPTC-TACSTD2-3

Target Antigen:

Tumor-associated Calcium Signal Transducer 2

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This table shows the data for pairing of the three CPTC-TACSTD2 antibodies. (792.7 KB)

CPTC-TACSTD2-3 pairing data

Result: Positive

This table shows the data for pairing of the three CPTC-TACSTD2 antibodies.


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-TACSTD2-3. Titer: 1:25000 Click image to enlarge

CPTC-TACSTD2-3 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-TACSTD2-3. Titer: 1:25000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-TACSTD2-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-TACSTD2-3 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-TACSTD2-3 as primary Ab against TDP2 (rAg 00007) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-TACSTD2-3 Western blot

Result: Positive

Western Blot using CPTC-TACSTD2-3 as primary Ab against TDP2 (rAg 00007) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

00007

Antigen Name:

Tumor-associated Calcium Signal Transducer 2

CPTC Name:

CPTC-TACSTD2

Keywords:

M1S1; EGP1; tumor-associated calcium signal transducer 2; GA7331; TROP2; GP50; GA733-1; cell surface glycoprotein TROP2; EGP-1; epithelial glycoprotein-1; Cell surface glycoprotein Trop-2; gastrointestinal tumor-associated antigen GA7331; Membrane component chromosome 1 surface marker 1; membrane component, chromosome 1, surface marker 1; Pancreatic carcinoma marker protein GA733-1; pancreatic carcinoma marker protein GA7331; 40kD glycoprotein, identified by monoclonal antibody GA733

Function:

This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy. May function as a growth factor receptor.

Chromosomal Localization:

1p32

Expression System:

E. coli

NCBI Accession Number:

NM_002353

Swiss Prot Accession Number:

P09758

DNA Source:

human ORFeome 1.1 collection, clone BC009409

Immunogen:

Recombinant Domain

Vector Name:

11725-X04-008

Extinction Coefficient:

Buffers:

Expressed Sequence:

QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARM
SAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNS
VGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLF
RERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDI
KGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTHHHHHH

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

28321

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of TACSTD2 (Ag 00007) with molecular weight standards in lane 1
Click image to enlarge

CPTC-TACSTD2 PAGE

PAGE of TACSTD2 (Ag 00007) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com