Catalog Number:
CPTC-Senp6 derived frame shift peptide (mouse)-1
Target Antigen:
Senp6 derived frame shift peptide (mouse) Peptide 1
Isotype:
IgG2b
Species:
Mouse Monoclonal Antibody
Last Updated:
10/08/2019
Antigen Recognition(s):
Peptide
Result: Positive
IPMS using CPTC-Senp6 derived frame shift peptide (mouse)-1 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel).
Result: Positive
Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse)-1 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285).
Result: Positive
Western Blot using CPTC-Senp6 derived frame shift peptide (mouse)-1 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) (lane 2). Also included are molecular wt. standards (lane 1).
Analysis was carried out on a tricine gel.
Catalog Number:
CPTC-Senp6 derived frame shift peptide (mouse)-2
Target Antigen:
Senp6 derived frame shift peptide (mouse) Peptide 1
Isotype:
IgG2c
Species:
Mouse Monoclonal Antibody
Last Updated:
10/08/2019
Antigen Recognition(s):
Peptide
Result: Positive
IPMS using CPTC-Senp6 derived frame shift peptide (mouse)-1 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse)-2 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel).
Result: Positive
Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse)-2 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285).
Result: Positive
Western Blot using CPTC-Senp6 derived frame shift peptide (mouse)-2 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) (lane 2). Also included are molecular wt. standards (lane 1).
Analysis was carried out on a tricine gel.
Catalog Number:
CPTC-Senp6 derived frame shift peptide (mouse)-3
Target Antigen:
Senp6 derived frame shift peptide (mouse) Peptide 1
Isotype:
IgG2b
Species:
Mouse Monoclonal Antibody
Last Updated:
10/08/2019
Antigen Recognition(s):
Peptide
Result: Positive
IPMS using CPTC-Senp6 derived frame shift peptide (mouse)-3 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel).
Result: Positive
Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse)-3 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285).
Result: Positive
Western Blot using CPTC-Senp6 derived frame shift peptide (mouse)-3 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) (lane 2). Also included are molecular wt. standards (lane 1).
Analysis was carried out on a tricine gel.
Catalog Number:
CPTC-Senp6 derived frame shift peptide (mouse)-4
Target Antigen:
Senp6 derived frame shift peptide (mouse) Peptide 1
Isotype:
IgG2b
Species:
Mouse Monoclonal Antibody
Last Updated:
10/08/2019
Antigen Recognition(s):
Peptide
Result: Positive
IPMS using CPTC-Senp6 derived frame shift peptide (mouse)-1 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse)-4 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel).
Result: Positive
Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse)-4 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285).
Result: Positive
Western Blot using CPTC-Senp6 derived frame shift peptide (mouse)-4 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) (lane 2). Also included are molecular wt. standards (lane 1).
Analysis was carried out on a tricine gel.
Catalog Number:
CPTC-Senp6 derived frame shift peptide (mouse)-5
Target Antigen:
Senp6 derived frame shift peptide (mouse) Peptide 1
Isotype:
IgG
Species:
Rabbit Recombinant Cloned Antibody
Last Updated:
02/27/2020
Antigen Recognition(s):
Peptide
Result: Positive
IPMS using CPTC-Senp6 derived frame shift peptide (mouse) - 5 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse) - 1 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel).
Result: Positive
Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse) - 5 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse) -1 (NCI ID 00285)
Result: Positive
Western blot using CPTC-Senp6 derived frame shift peptide (mouse) -5 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse) -1 (NCI ID 00285) (lane 2). Also included are molecular weight standards (lane 1). Analysis was carried out on a tricine gel.
NCI Identification Number:
00285
Antigen Name:
Senp6 derived frame shift peptide (mouse) Peptide 1
CPTC Name:
CPTC-Senp6 derived frame shift peptide (mouse) Peptide 1
Aliases:
Function:
This frame shift peptide occurs in a genetically engineered mouse model of Lynch Syndrome (MSH2 germline mutation). Single base deletion mutations in a poly A repeat at the mouse Senp6 locus result in this frame shift in a recurrent manner. An extended version of this (with 10 additional amino acids in the frame shift peptide) is a component of an experimental vaccine developed and shown to have colon cancer preventive efficacy in the mouse model (unpublished results). The preclinical vaccine was developed with support of the NCI Division of Cancer Prevention PREVENT Cancer Program based on an application by Drs. Steven Lipkin (Weill Cornell Medicine) and Magnus von Knebel Doeberitz (German Cancer Research Center). While the mouse Senp6 and human SENP6 genes are thought to have analogous functions, the human gene sequence differs at the poly A repeat. The sequence of the mouse Senp6 frame shift peptide is a mouse neoantigen and not found in current (September, 2019) protein databases.
Chromosomal Localization:
Accession Number:
na
UniProt Accession Number:
DNA Source:
The preclinical vaccine was developed with support of the NCI Division of Cancer Prevention PREVENT Cancer Program based on an application by Drs. Steven Lipkin (Weill Cornell Medicine) and Magnus von Knebel Doeberitz (German Cancer Research Center).
Immunogen:
Synthetic Peptide
Vector Name:
N/A
Extinction Coefficient:
Buffers:
Lyopholized
Expressed Sequence:
KNQVTENLRARTFVIEPKVRMASGMNASVLYII
Native Sequence:
Calculated Isoelectric Point:
Molecular Weight:
3630
Last Updated:
08/23/2020
No SOPs available.
Get it for free at Adobe.com