Senp6 derived frame shift peptide (mouse) Peptide 1


Background

Catalog Number:

CPTC-Senp6 derived frame shift peptide (mouse)-1

Target Antigen:

Senp6 derived frame shift peptide (mouse) Peptide 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

10/08/2019

Antigen Recognition(s):

Peptide

Characterization Data [Compare Characterization Data]
  IP
Click to enlarge image IPMS using CPTC-Senp6 derived frame shift peptide (mouse)-1 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel). Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-1 peptide IPMS

Result: Positive

IPMS using CPTC-Senp6 derived frame shift peptide (mouse)-1 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel).


  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse)-1 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285). Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-1 peptide ELISA

Result: High Binding

Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse)-1 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Senp6 derived frame shift peptide (mouse)-1 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285)  (lane 2). Also included are molecular wt. standards (lane 1).
Analysis was carried out on a tricine gel. Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-1 peptide WB

Result: Positive

Western Blot using CPTC-Senp6 derived frame shift peptide (mouse)-1 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) (lane 2). Also included are molecular wt. standards (lane 1).
Analysis was carried out on a tricine gel.


Characterization SOP Files

Background

Catalog Number:

CPTC-Senp6 derived frame shift peptide (mouse)-2

Target Antigen:

Senp6 derived frame shift peptide (mouse) Peptide 1

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

10/08/2019

Antigen Recognition(s):

Peptide

Characterization Data [Compare Characterization Data]
  IP
Click to enlarge image IPMS using CPTC-Senp6 derived frame shift peptide (mouse)-1 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse)-2 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel). Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-2 IPMS

Result: Positive

IPMS using CPTC-Senp6 derived frame shift peptide (mouse)-1 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse)-2 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel).


  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse)-2 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285). Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-2 peptide ELISA

Result: High Binding

Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse)-2 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Senp6 derived frame shift peptide (mouse)-2 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285)  (lane 2). Also included are molecular wt. standards (lane 1).
Analysis was carried out on a tricine gel.
Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-2 WB

Result: Positive

Western Blot using CPTC-Senp6 derived frame shift peptide (mouse)-2 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) (lane 2). Also included are molecular wt. standards (lane 1).
Analysis was carried out on a tricine gel.


Characterization SOP Files

Background

Catalog Number:

CPTC-Senp6 derived frame shift peptide (mouse)-3

Target Antigen:

Senp6 derived frame shift peptide (mouse) Peptide 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

10/08/2019

Antigen Recognition(s):

Peptide

Characterization Data [Compare Characterization Data]
  IP
Click to enlarge image IPMS using CPTC-Senp6 derived frame shift peptide (mouse)-3 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel). Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-3 peptide IPMS

Result: Positive

IPMS using CPTC-Senp6 derived frame shift peptide (mouse)-3 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel).


  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse)-3 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285). Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-3 peptide ELISA

Result: High Binding

Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse)-3 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Senp6 derived frame shift peptide (mouse)-3 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285)  (lane 2). Also included are molecular wt. standards (lane 1).
Analysis was carried out on a tricine gel. Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-3 peptide WB

Result: Positive

Western Blot using CPTC-Senp6 derived frame shift peptide (mouse)-3 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) (lane 2). Also included are molecular wt. standards (lane 1).
Analysis was carried out on a tricine gel.


Characterization SOP Files

Background

Catalog Number:

CPTC-Senp6 derived frame shift peptide (mouse)-4

Target Antigen:

Senp6 derived frame shift peptide (mouse) Peptide 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

10/08/2019

Antigen Recognition(s):

Peptide

Characterization Data [Compare Characterization Data]
  IP
Click to enlarge image IPMS using CPTC-Senp6 derived frame shift peptide (mouse)-1 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse)-4 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel). Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-4 IPMS

Result: Positive

IPMS using CPTC-Senp6 derived frame shift peptide (mouse)-1 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse)-4 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel).


  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse)-4 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285). Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-4 peptide ELISA

Result: High Binding

Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse)-4 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Senp6 derived frame shift peptide (mouse)-4 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285)  (lane 2). Also included are molecular wt. standards (lane 1).
Analysis was carried out on a tricine gel. Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-4 peptide WB

Result: Positive

Western Blot using CPTC-Senp6 derived frame shift peptide (mouse)-4 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse)-1 (NCI ID 00285) (lane 2). Also included are molecular wt. standards (lane 1).
Analysis was carried out on a tricine gel.


Characterization SOP Files

Background

Catalog Number:

CPTC-Senp6 derived frame shift peptide (mouse)-5

Target Antigen:

Senp6 derived frame shift peptide (mouse) Peptide 1

Isotype:

IgG

Species:

Rabbit Recombinant Cloned Antibody

Last Updated:

02/27/2020

Antigen Recognition(s):

Peptide

Characterization Data [Compare Characterization Data]
  IP
Click to enlarge image IPMS using CPTC-Senp6 derived frame shift peptide (mouse) - 5 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse) - 1 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel). Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse) - 5 peptide IPMS

Result: Positive

IPMS using CPTC-Senp6 derived frame shift peptide (mouse) - 5 as capture Ab against CPTC-Senp6 derived frame shift peptide (mouse) - 1 (NCI ID 00285) in bottom panel. Also included reference of Ag QC (top panel).


  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse) - 5 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse) -1 (NCI ID 00285) Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse)-5 peptide ELISA

Result: High Binding

Indirect ELISA using CPTC-Senp6 derived frame shift peptide (mouse) - 5 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse) -1 (NCI ID 00285)


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western blot using CPTC-Senp6 derived frame shift peptide (mouse) -5 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse) -1 (NCI ID 00285) (lane 2). Also included are molecular weight standards (lane 1). Analysis was carried out on a tricine gel. Click image to enlarge

CPTC-Senp6 derived frame shift peptide (mouse) - 5 peptide WB

Result: Positive

Western blot using CPTC-Senp6 derived frame shift peptide (mouse) -5 as primary Ab against CPTC-Senp6 derived frame shift peptide (mouse) -1 (NCI ID 00285) (lane 2). Also included are molecular weight standards (lane 1). Analysis was carried out on a tricine gel.


Characterization SOP Files

Background

NCI Identification Number:

00285

Antigen Name:

Senp6 derived frame shift peptide (mouse) Peptide 1

CPTC Name:

CPTC-Senp6 derived frame shift peptide (mouse) Peptide 1

Aliases:

Function:

This frame shift peptide occurs in a genetically engineered mouse model of Lynch Syndrome (MSH2 germline mutation). Single base deletion mutations in a poly A repeat at the mouse Senp6 locus result in this frame shift in a recurrent manner. An extended version of this (with 10 additional amino acids in the frame shift peptide) is a component of an experimental vaccine developed and shown to have colon cancer preventive efficacy in the mouse model (unpublished results). The preclinical vaccine was developed with support of the NCI Division of Cancer Prevention PREVENT Cancer Program based on an application by Drs. Steven Lipkin (Weill Cornell Medicine) and Magnus von Knebel Doeberitz (German Cancer Research Center). While the mouse Senp6 and human SENP6 genes are thought to have analogous functions, the human gene sequence differs at the poly A repeat. The sequence of the mouse Senp6 frame shift peptide is a mouse neoantigen and not found in current (September, 2019) protein databases.

Chromosomal Localization:

Accession Number:

na

UniProt Accession Number:

DNA Source:

The preclinical vaccine was developed with support of the NCI Division of Cancer Prevention PREVENT Cancer Program based on an application by Drs. Steven Lipkin (Weill Cornell Medicine) and Magnus von Knebel Doeberitz (German Cancer Research Center).

Immunogen:

Synthetic Peptide

Vector Name:

N/A

Extinction Coefficient:

Buffers:

Lyopholized

Expressed Sequence:

KNQVTENLRARTFVIEPKVRMASGMNASVLYII

Native Sequence:

Calculated Isoelectric Point:

Molecular Weight:

3630

Last Updated:

08/23/2020

Links

Characterization Data

SOPs

No SOPs available.

Don't have Adobe Reader™?

Get it for free at Adobe.com